Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2776757..2777402 | Replicon | chromosome |
Accession | NZ_CP098777 | ||
Organism | Cronobacter sakazakii strain JXES-28 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6L3QTA3 |
Locus tag | NES82_RS13630 | Protein ID | WP_004388208.1 |
Coordinates | 2777040..2777402 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6L3TU83 |
Locus tag | NES82_RS13625 | Protein ID | WP_004388209.1 |
Coordinates | 2776757..2777053 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NES82_RS13615 (NES82_13620) | 2774411..2775259 | - | 849 | WP_105572482.1 | DNA-3-methyladenine glycosylase 2 | - |
NES82_RS13620 (NES82_13625) | 2775395..2776747 | + | 1353 | WP_252142304.1 | molecular chaperone | - |
NES82_RS13625 (NES82_13630) | 2776757..2777053 | - | 297 | WP_004388209.1 | XRE family transcriptional regulator | Antitoxin |
NES82_RS13630 (NES82_13635) | 2777040..2777402 | - | 363 | WP_004388208.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NES82_RS13635 (NES82_13640) | 2777633..2778880 | + | 1248 | WP_004388207.1 | MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit | - |
NES82_RS13640 (NES82_13645) | 2778880..2782002 | + | 3123 | WP_054624226.1 | MdtB/MuxB family multidrug efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14197.07 Da Isoelectric Point: 8.0154
>T248067 WP_004388208.1 NZ_CP098777:c2777402-2777040 [Cronobacter sakazakii]
MAWTVIFTDRFNDWYQQQPEGLQDRIAALLWNLRYSGPLVGRPLVDTVKGSRYPNLKELRVQYGGEPWRVFFAFDAERQA
VVLCAGNKRSQKHFYDALIRQAEEEFFLHVQAMERRNENS
MAWTVIFTDRFNDWYQQQPEGLQDRIAALLWNLRYSGPLVGRPLVDTVKGSRYPNLKELRVQYGGEPWRVFFAFDAERQA
VVLCAGNKRSQKHFYDALIRQAEEEFFLHVQAMERRNENS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L3QTA3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L3TU83 |