Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2049319..2049884 | Replicon | chromosome |
| Accession | NZ_CP098777 | ||
| Organism | Cronobacter sakazakii strain JXES-28 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NES82_RS09995 | Protein ID | WP_032989567.1 |
| Coordinates | 2049319..2049597 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | NES82_RS10000 | Protein ID | WP_004388462.1 |
| Coordinates | 2049597..2049884 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NES82_RS09980 (NES82_09985) | 2044385..2046322 | + | 1938 | WP_161574961.1 | methyl-accepting chemotaxis protein | - |
| NES82_RS09985 (NES82_09990) | 2046430..2047416 | + | 987 | WP_007888785.1 | SDR family oxidoreductase | - |
| NES82_RS09990 (NES82_09995) | 2047418..2049022 | - | 1605 | WP_161574962.1 | alpha-amylase family protein | - |
| NES82_RS09995 (NES82_10000) | 2049319..2049597 | + | 279 | WP_032989567.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NES82_RS10000 (NES82_10005) | 2049597..2049884 | + | 288 | WP_004388462.1 | HigA family addiction module antitoxin | Antitoxin |
| NES82_RS10005 (NES82_10010) | 2049944..2052061 | - | 2118 | WP_161574963.1 | TonB-dependent receptor PqqU | - |
| NES82_RS10010 (NES82_10015) | 2052339..2053397 | + | 1059 | WP_038880466.1 | YncE family protein | - |
| NES82_RS10015 (NES82_10020) | 2053428..2054294 | - | 867 | WP_105551838.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10585.11 Da Isoelectric Point: 10.0888
>T248062 WP_032989567.1 NZ_CP098777:2049319-2049597 [Cronobacter sakazakii]
MIRSFRHKGLQRYFETGSTAGIHALHARKISLRLAVLNQAIRPADVDLPGFFLHPLTGDRKGIWAVTVSGNWRITFEFRD
GDVFIVNYEDYH
MIRSFRHKGLQRYFETGSTAGIHALHARKISLRLAVLNQAIRPADVDLPGFFLHPLTGDRKGIWAVTVSGNWRITFEFRD
GDVFIVNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|