Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1763925..1764595 | Replicon | chromosome |
| Accession | NZ_CP098777 | ||
| Organism | Cronobacter sakazakii strain JXES-28 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NES82_RS08740 | Protein ID | WP_080320917.1 |
| Coordinates | 1763925..1764221 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NES82_RS08745 | Protein ID | WP_032989868.1 |
| Coordinates | 1764254..1764595 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NES82_RS08720 (NES82_08725) | 1759540..1760367 | - | 828 | WP_105573149.1 | ammonia-dependent NAD(+) synthetase | - |
| NES82_RS08725 (NES82_08730) | 1760610..1760951 | + | 342 | WP_004387341.1 | osmotically-inducible lipoprotein OsmE | - |
| NES82_RS08730 (NES82_08735) | 1761064..1763319 | - | 2256 | WP_161574344.1 | catalase HPII | - |
| NES82_RS08735 (NES82_08740) | 1763531..1763761 | + | 231 | WP_041460525.1 | cell division activator CedA | - |
| NES82_RS08740 (NES82_08745) | 1763925..1764221 | + | 297 | WP_080320917.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NES82_RS08745 (NES82_08750) | 1764254..1764595 | + | 342 | WP_032989868.1 | HigA family addiction module antitoxin | Antitoxin |
| NES82_RS08750 (NES82_08755) | 1764706..1766097 | - | 1392 | WP_004386567.1 | L-cystine transporter | - |
| NES82_RS08755 (NES82_08760) | 1766232..1766822 | - | 591 | WP_004386566.1 | metal-dependent hydrolase | - |
| NES82_RS08760 (NES82_08765) | 1766936..1767691 | - | 756 | WP_007867041.1 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD | - |
| NES82_RS08765 (NES82_08770) | 1767879..1768547 | - | 669 | WP_038859934.1 | hexitol phosphatase HxpB | - |
| NES82_RS08770 (NES82_08775) | 1768706..1769242 | + | 537 | WP_004386563.1 | YniB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11429.94 Da Isoelectric Point: 9.6980
>T248061 WP_080320917.1 NZ_CP098777:1763925-1764221 [Cronobacter sakazakii]
MQKHIGSFRDAWLAAFFVYSTPHRNIPAEIHTTLARKLDIINAATSYRDLRSPPGNRFEALSGKLQGYSSIRVNHHYRLI
FRWVEGKAEDLYLDPHDY
MQKHIGSFRDAWLAAFFVYSTPHRNIPAEIHTTLARKLDIINAATSYRDLRSPPGNRFEALSGKLQGYSSIRVNHHYRLI
FRWVEGKAEDLYLDPHDY
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|