Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 741608..742383 | Replicon | chromosome |
| Accession | NZ_CP098769 | ||
| Organism | Klebsiella pneumoniae strain TH12846 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | NE243_RS03710 | Protein ID | WP_004150910.1 |
| Coordinates | 741898..742383 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | NE243_RS03705 | Protein ID | WP_004150912.1 |
| Coordinates | 741608..741901 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE243_RS03685 (NE243_03685) | 736816..737418 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
| NE243_RS03690 (NE243_03690) | 737516..738427 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| NE243_RS03695 (NE243_03695) | 738428..739576 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| NE243_RS03700 (NE243_03700) | 739587..740963 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| NE243_RS03705 (NE243_03705) | 741608..741901 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| NE243_RS03710 (NE243_03710) | 741898..742383 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| NE243_RS03715 (NE243_03715) | 743087..743680 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| NE243_RS03720 (NE243_03720) | 743777..743993 | + | 217 | Protein_731 | transposase | - |
| NE243_RS03725 (NE243_03725) | 744599..745471 | + | 873 | WP_004188557.1 | ParA family protein | - |
| NE243_RS03730 (NE243_03730) | 745471..745854 | + | 384 | WP_004150906.1 | hypothetical protein | - |
| NE243_RS03735 (NE243_03735) | 745847..747214 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 743777..743929 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T248030 WP_004150910.1 NZ_CP098769:741898-742383 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |