Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328214..328800 Replicon chromosome
Accession NZ_CP098769
Organism Klebsiella pneumoniae strain TH12846

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NE243_RS01525 Protein ID WP_002920800.1
Coordinates 328432..328800 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag NE243_RS01520 Protein ID WP_002920802.1
Coordinates 328214..328435 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE243_RS01500 (NE243_01500) 324371..325297 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NE243_RS01505 (NE243_01505) 325294..326571 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
NE243_RS01510 (NE243_01510) 326568..327335 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NE243_RS01515 (NE243_01515) 327337..328050 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NE243_RS01520 (NE243_01520) 328214..328435 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NE243_RS01525 (NE243_01525) 328432..328800 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NE243_RS01530 (NE243_01530) 329073..330389 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NE243_RS01535 (NE243_01535) 330496..331383 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NE243_RS01540 (NE243_01540) 331380..332225 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NE243_RS01545 (NE243_01545) 332227..333297 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 325294..334034 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T248028 WP_002920800.1 NZ_CP098769:328432-328800 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT248028 WP_002920802.1 NZ_CP098769:328214-328435 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References