Detailed information of TA system TA248021

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 23850..24114
• Replicon: plasmid pKP167-98
• Accession: NZ_CP098760
• Organism: Klebsiella pneumoniae strain KP167

Toxin (Protein)

• Gene name: pndA
• Uniprot ID: -
• Locus tag: ND678_RS27295
• Protein ID: WP_024179505.1
• Coordinates: 23850..24002 (-)
• Length: 51 a.a.

Antitoxin (RNA)

Gene name	pndB
Locus tag	-
Coordinates	24054..24114 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ND678_RS27275 (20682)	20682..21344	+	663	WP_060527638.1	plasmid IncI1-type surface exclusion protein ExcA	-
ND678_RS27280 (21416)	21416..21625	-	210	WP_000062603.1	HEAT repeat domain-containing protein	-
ND678_RS27285 (22018)	22018..22194	+	177	WP_180335155.1	hypothetical protein	-
ND678_RS27825 (22256)	22256..22354	-	99	WP_022630883.1	DinQ-like type I toxin DqlB	-
- (23083)	23083..23134	+	52	NuclAT_1	-	-
- (23083)	23083..23134	+	52	NuclAT_1	-	-
- (23083)	23083..23134	+	52	NuclAT_1	-	-
- (23083)	23083..23134	+	52	NuclAT_1	-	-
ND678_RS27290 (23527)	23527..23778	+	252	WP_001291962.1	hypothetical protein	-
ND678_RS27295 (23850)	23850..24002	-	153	WP_024179505.1	Hok/Gef family protein	Toxin
- (24054)	24054..24114	+	61	NuclAT_0	-	Antitoxin
- (24054)	24054..24114	+	61	NuclAT_0	-	Antitoxin
- (24054)	24054..24114	+	61	NuclAT_0	-	Antitoxin
- (24054)	24054..24114	+	61	NuclAT_0	-	Antitoxin
ND678_RS27300 (24294)	24294..25502	+	1209	WP_064148469.1	IncI1-type conjugal transfer protein TrbA	-
ND678_RS27305 (25521)	25521..26591	+	1071	WP_064148470.1	IncI1-type conjugal transfer protein TrbB	-
ND678_RS27310 (26584)	26584..28875	+	2292	WP_077265944.1	F-type conjugative transfer protein TrbC	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	qnrB2 / sul1	-	1..98478	98478

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (7-46)

Sequences

Toxin

Protein

• Length: 51 a.a.
• Molecular weight: 5743.07 Da
• Isoelectric Point: 8.7948

>T248021 WP_024179505.1 NZ_CP098760:c24002-23850 [Klebsiella pneumoniae]
MPQRTFLMMLIVVCVTILCFVWIVRDSLCGLRLQQGNTVLVATLAYEVKR

Nucleotide

• Length: 153 bp

Antitoxin

Nucleotide

• Length: 61 bp

>AT248021 NZ_CP098760:24054-24114 [Klebsiella pneumoniae]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Structures

Antitoxin