Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 23850..24114 | Replicon | plasmid pKP167-98 |
| Accession | NZ_CP098760 | ||
| Organism | Klebsiella pneumoniae strain KP167 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | - |
| Locus tag | ND678_RS27295 | Protein ID | WP_024179505.1 |
| Coordinates | 23850..24002 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 24054..24114 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND678_RS27275 (20682) | 20682..21344 | + | 663 | WP_060527638.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| ND678_RS27280 (21416) | 21416..21625 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| ND678_RS27285 (22018) | 22018..22194 | + | 177 | WP_180335155.1 | hypothetical protein | - |
| ND678_RS27825 (22256) | 22256..22354 | - | 99 | WP_022630883.1 | DinQ-like type I toxin DqlB | - |
| - (23083) | 23083..23134 | + | 52 | NuclAT_1 | - | - |
| - (23083) | 23083..23134 | + | 52 | NuclAT_1 | - | - |
| - (23083) | 23083..23134 | + | 52 | NuclAT_1 | - | - |
| - (23083) | 23083..23134 | + | 52 | NuclAT_1 | - | - |
| ND678_RS27290 (23527) | 23527..23778 | + | 252 | WP_001291962.1 | hypothetical protein | - |
| ND678_RS27295 (23850) | 23850..24002 | - | 153 | WP_024179505.1 | Hok/Gef family protein | Toxin |
| - (24054) | 24054..24114 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (24054) | 24054..24114 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (24054) | 24054..24114 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (24054) | 24054..24114 | + | 61 | NuclAT_0 | - | Antitoxin |
| ND678_RS27300 (24294) | 24294..25502 | + | 1209 | WP_064148469.1 | IncI1-type conjugal transfer protein TrbA | - |
| ND678_RS27305 (25521) | 25521..26591 | + | 1071 | WP_064148470.1 | IncI1-type conjugal transfer protein TrbB | - |
| ND678_RS27310 (26584) | 26584..28875 | + | 2292 | WP_077265944.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrB2 / sul1 | - | 1..98478 | 98478 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5743.07 Da Isoelectric Point: 8.7948
>T248021 WP_024179505.1 NZ_CP098760:c24002-23850 [Klebsiella pneumoniae]
MPQRTFLMMLIVVCVTILCFVWIVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWIVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT248021 NZ_CP098760:24054-24114 [Klebsiella pneumoniae]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|