Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 2785703..2786397 | Replicon | chromosome |
Accession | NZ_CP098757 | ||
Organism | Klebsiella oxytoca strain AHC-6 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | - |
Locus tag | NDX50_RS13140 | Protein ID | WP_263441988.1 |
Coordinates | 2785703..2786107 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | A0A285AZA0 |
Locus tag | NDX50_RS13145 | Protein ID | WP_073395581.1 |
Coordinates | 2786104..2786397 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDX50_RS13120 (NDX50_13110) | 2782516..2783352 | - | 837 | WP_064398616.1 | DUF2971 domain-containing protein | - |
NDX50_RS13125 (NDX50_13115) | 2783659..2783853 | + | 195 | WP_064372954.1 | hypothetical protein | - |
NDX50_RS13130 (NDX50_13120) | 2783840..2784271 | - | 432 | WP_064372953.1 | hypothetical protein | - |
NDX50_RS13135 (NDX50_13125) | 2784317..2784952 | - | 636 | WP_064398618.1 | DUF4145 domain-containing protein | - |
NDX50_RS13140 (NDX50_13130) | 2785703..2786107 | - | 405 | WP_263441988.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
NDX50_RS13145 (NDX50_13135) | 2786104..2786397 | - | 294 | WP_073395581.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NDX50_RS13150 (NDX50_13140) | 2786938..2787837 | + | 900 | WP_201505862.1 | DUF4365 domain-containing protein | - |
NDX50_RS13155 (NDX50_13145) | 2787921..2788901 | + | 981 | WP_265782353.1 | hypothetical protein | - |
NDX50_RS13160 (NDX50_13150) | 2788978..2790231 | + | 1254 | WP_201505864.1 | DUF3644 domain-containing protein | - |
NDX50_RS13165 (NDX50_13155) | 2790272..2790481 | + | 210 | WP_133116564.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2779421..2807051 | 27630 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15512.89 Da Isoelectric Point: 7.1284
>T248000 WP_263441988.1 NZ_CP098757:c2786107-2785703 [Klebsiella oxytoca]
MSIRIFKSALIRQQLIQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
MSIRIFKSALIRQQLIQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLVKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|