Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 7306..7520 | Replicon | plasmid pEFM9-3 |
Accession | NZ_CP098746 | ||
Organism | Enterococcus faecalis strain M9 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | NDO76_RS13810 | Protein ID | WP_002360667.1 |
Coordinates | 7410..7520 (-) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 7306..7370 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDO76_RS13790 | 3004..4020 | - | 1017 | WP_033593833.1 | replication initiator protein A | - |
NDO76_RS13795 | 4683..5534 | + | 852 | WP_002362419.1 | ParA family protein | - |
NDO76_RS13800 | 5544..6086 | + | 543 | WP_086321354.1 | hypothetical protein | - |
NDO76_RS13805 | 6871..7170 | - | 300 | WP_010817802.1 | hypothetical protein | - |
- | 7306..7370 | + | 65 | - | - | Antitoxin |
NDO76_RS13810 | 7410..7520 | - | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NDO76_RS13815 | 8015..8332 | + | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
NDO76_RS13820 | 8368..9036 | + | 669 | WP_002403283.1 | CPBP family intramembrane metalloprotease | - |
NDO76_RS13825 | 9153..9407 | + | 255 | WP_002394800.1 | hypothetical protein | - |
NDO76_RS13830 | 9567..9800 | - | 234 | WP_002394799.1 | hypothetical protein | - |
NDO76_RS13835 | 9802..10113 | - | 312 | WP_251846816.1 | hypothetical protein | - |
NDO76_RS13840 | 10103..10723 | - | 621 | WP_002367784.1 | recombinase family protein | - |
NDO76_RS13845 | 11167..11817 | - | 651 | WP_251846817.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..49313 | 49313 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T247984 WP_002360667.1 NZ_CP098746:c7520-7410 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT247984 NZ_CP098746:7306-7370 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|