Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-RNAII/- |
| Location | 2554166..2554428 | Replicon | chromosome |
| Accession | NZ_CP098743 | ||
| Organism | Enterococcus faecalis strain M9 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | NDO76_RS12320 | Protein ID | WP_002392696.1 |
| Coordinates | 2554285..2554428 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 2554166..2554311 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDO76_RS12305 (2549532) | 2549532..2550245 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| NDO76_RS12310 (2550507) | 2550507..2553251 | + | 2745 | WP_016616452.1 | glycosyl hydrolase family 65 protein | - |
| NDO76_RS12315 (2553266) | 2553266..2553916 | + | 651 | WP_016616451.1 | beta-phosphoglucomutase | - |
| - (2553985) | 2553985..2554119 | + | 135 | NuclAT_11 | - | - |
| - (2554166) | 2554166..2554311 | + | 146 | NuclAT_10 | - | Antitoxin |
| - (2554166) | 2554166..2554352 | + | 187 | NuclAT_4 | - | - |
| NDO76_RS12320 (2554285) | 2554285..2554428 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| NDO76_RS12325 (2554660) | 2554660..2555631 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| NDO76_RS12330 (2555806) | 2555806..2556243 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| NDO76_RS12335 (2556376) | 2556376..2556930 | - | 555 | WP_251846717.1 | Maf family protein | - |
| NDO76_RS12340 (2556955) | 2556955..2559087 | - | 2133 | WP_002368469.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T247974 WP_002392696.1 NZ_CP098743:c2554428-2554285 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 146 bp
>AT247974 NZ_CP098743:2554166-2554311 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGAGATGCGTCAACATACCTCTCTGATGTAGAACCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGTGCTATAATGAAAACGAAAAGAGAGAGATGCGTCAACATACCTCTCTGATGTAGAACCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|