Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 304008..304203 | Replicon | chromosome |
Accession | NZ_CP098743 | ||
Organism | Enterococcus faecalis strain M9 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | NDO76_RS01525 | Protein ID | WP_122975133.1 |
Coordinates | 304108..304203 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 304008..304073 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDO76_RS01510 (299635) | 299635..301383 | + | 1749 | WP_016615923.1 | PTS transporter subunit EIIC | - |
NDO76_RS01515 (301374) | 301374..303407 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
NDO76_RS01520 (303418) | 303418..303852 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (304008) | 304008..304073 | + | 66 | NuclAT_15 | - | Antitoxin |
NDO76_RS01525 (304108) | 304108..304203 | - | 96 | WP_122975133.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NDO76_RS01530 (304449) | 304449..306221 | + | 1773 | WP_251846729.1 | PTS mannitol-specific transporter subunit IIBC | - |
NDO76_RS01535 (306236) | 306236..306673 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
NDO76_RS01540 (306688) | 306688..307842 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
NDO76_RS01545 (307910) | 307910..309025 | - | 1116 | WP_251846730.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.5869
>T247969 WP_122975133.1 NZ_CP098743:c304203-304108 [Enterococcus faecalis]
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT247969 NZ_CP098743:304008-304073 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|