Detailed information of TA system TA247965

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 79333..79759
• Replicon: plasmid unnamed1
• Accession: NZ_CP098742
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NCG87_RS23840
• Protein ID: WP_001372321.1
• Coordinates: 79333..79458 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	79535..79759 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NCG87_RS23805 (74356)	74356..74583	-	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-
NCG87_RS23810 (74720)	74720..75391	-	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
NCG87_RS23815 (75585)	75585..75968	-	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NCG87_RS23820 (76303)	76303..76893	+	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
NCG87_RS23825 (77190)	77190..78011	-	822	WP_001234445.1	DUF932 domain-containing protein	-
NCG87_RS23830 (78122)	78122..78418	-	297	WP_001272251.1	hypothetical protein	-
NCG87_RS23835 (78718)	78718..79014	+	297	Protein_93	hypothetical protein	-
NCG87_RS23840 (79333)	79333..79458	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NCG87_RS23845 (79400)	79400..79549	-	150	Protein_95	plasmid maintenance protein Mok	-
- (79535)	79535..79759	-	225	NuclAT_0	-	Antitoxin
- (79535)	79535..79759	-	225	NuclAT_0	-	Antitoxin
- (79535)	79535..79759	-	225	NuclAT_0	-	Antitoxin
- (79535)	79535..79759	-	225	NuclAT_0	-	Antitoxin
NCG87_RS23850 (79771)	79771..80490	-	720	WP_001276217.1	plasmid SOS inhibition protein A	-
NCG87_RS23855 (80487)	80487..80921	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NCG87_RS23860 (80990)	80990..83013	-	2024	Protein_98	ParB/RepB/Spo0J family partition protein	-
NCG87_RS23865 (83079)	83079..83312	-	234	WP_000005990.1	DUF905 family protein	-
NCG87_RS23870 (83375)	83375..83914	-	540	WP_000290841.1	single-stranded DNA-binding protein	-
NCG87_RS23875 (83940)	83940..84146	-	207	WP_000547975.1	hypothetical protein	-
NCG87_RS23880 (84387)	84387..84668	-	282	WP_072277694.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / tet(B)	iutA / iucD / iucC / iucB / iucA	1..109442	109442

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T247965 WP_001372321.1 NZ_CP098742:c79458-79333 [Salmonella enterica subsp. enterica serovar Typhimurium]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT247965 NZ_CP098742:c79759-79535 [Salmonella enterica subsp. enterica serovar Typhimurium]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin