Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2776777..2777558 | Replicon | chromosome |
Accession | NZ_CP098741 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NCG87_RS13360 | Protein ID | WP_000626099.1 |
Coordinates | 2777067..2777558 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NCG87_RS13355 | Protein ID | WP_001110452.1 |
Coordinates | 2776777..2777070 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCG87_RS13320 (2772389) | 2772389..2773294 | + | 906 | WP_001268200.1 | YjiK family protein | - |
NCG87_RS13325 (2773633) | 2773633..2774091 | + | 459 | WP_000502119.1 | IS200/IS605-like element IS200F family transposase | - |
NCG87_RS13330 (2774300) | 2774300..2774569 | - | 270 | WP_010989096.1 | hypothetical protein | - |
NCG87_RS13335 (2774577) | 2774577..2774792 | - | 216 | WP_001595136.1 | hypothetical protein | - |
NCG87_RS13340 (2774815) | 2774815..2775102 | - | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NCG87_RS13345 (2775099) | 2775099..2775974 | - | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NCG87_RS13350 (2776239) | 2776239..2776460 | - | 222 | WP_001576552.1 | hypothetical protein | - |
NCG87_RS13355 (2776777) | 2776777..2777070 | + | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NCG87_RS13360 (2777067) | 2777067..2777558 | + | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NCG87_RS13365 (2777806) | 2777806..2778558 | - | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NCG87_RS13370 (2778661) | 2778661..2778735 | - | 75 | Protein_2597 | porin family protein | - |
NCG87_RS13375 (2779767) | 2779767..2780144 | - | 378 | WP_000916345.1 | EthD family reductase | - |
NCG87_RS13380 (2780216) | 2780216..2780548 | + | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NCG87_RS13385 (2780639) | 2780639..2780716 | + | 78 | Protein_2600 | helix-turn-helix domain-containing protein | - |
NCG87_RS13395 (2780987) | 2780987..2781562 | - | 576 | WP_001188509.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2773633..2774091 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T247957 WP_000626099.1 NZ_CP098741:2777067-2777558 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT247957 WP_001110452.1 NZ_CP098741:2776777-2777070 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |