Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2455178..2455780 | Replicon | chromosome |
Accession | NZ_CP098741 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | NCG87_RS11925 | Protein ID | WP_001159630.1 |
Coordinates | 2455178..2455489 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NCG87_RS11930 | Protein ID | WP_000362050.1 |
Coordinates | 2455490..2455780 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCG87_RS11890 (2450291) | 2450291..2450890 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
NCG87_RS11895 (2450884) | 2450884..2451756 | + | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
NCG87_RS11900 (2451753) | 2451753..2452190 | + | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
NCG87_RS11905 (2452235) | 2452235..2453176 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NCG87_RS11910 (2453191) | 2453191..2453637 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NCG87_RS11915 (2453634) | 2453634..2453945 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
NCG87_RS11920 (2454031) | 2454031..2454960 | - | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
NCG87_RS11925 (2455178) | 2455178..2455489 | + | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
NCG87_RS11930 (2455490) | 2455490..2455780 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
NCG87_RS11935 (2455827) | 2455827..2456756 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
NCG87_RS11940 (2456753) | 2456753..2457388 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NCG87_RS11945 (2457385) | 2457385..2458287 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T247956 WP_001159630.1 NZ_CP098741:2455178-2455489 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT247956 WP_000362050.1 NZ_CP098741:2455490-2455780 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|