Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1235354..1235944 | Replicon | chromosome |
| Accession | NZ_CP098732 | ||
| Organism | Acinetobacter tibetensis strain Y-23 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M5E07_RS06050 | Protein ID | WP_044738568.1 |
| Coordinates | 1235354..1235635 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | M5E07_RS06055 | Protein ID | WP_201706383.1 |
| Coordinates | 1235660..1235944 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5E07_RS06030 (M5E07_06030) | 1233936..1234115 | + | 180 | WP_252223006.1 | hypothetical protein | - |
| M5E07_RS06035 (M5E07_06035) | 1234179..1234439 | + | 261 | WP_252223009.1 | holin | - |
| M5E07_RS06040 (M5E07_06040) | 1234423..1234929 | + | 507 | WP_252223012.1 | lysozyme | - |
| M5E07_RS06045 (M5E07_06045) | 1235100..1235300 | + | 201 | WP_252223015.1 | hypothetical protein | - |
| M5E07_RS06050 (M5E07_06050) | 1235354..1235635 | + | 282 | WP_044738568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5E07_RS06055 (M5E07_06055) | 1235660..1235944 | + | 285 | WP_201706383.1 | HigA family addiction module antitoxin | Antitoxin |
| M5E07_RS06060 (M5E07_06060) | 1236188..1236904 | + | 717 | WP_252223018.1 | hypothetical protein | - |
| M5E07_RS06065 (M5E07_06065) | 1237045..1237608 | + | 564 | WP_252223021.1 | hypothetical protein | - |
| M5E07_RS06070 (M5E07_06070) | 1237611..1238387 | + | 777 | WP_252223024.1 | hypothetical protein | - |
| M5E07_RS06075 (M5E07_06075) | 1238421..1238813 | - | 393 | WP_252223027.1 | hypothetical protein | - |
| M5E07_RS06080 (M5E07_06080) | 1238972..1239769 | + | 798 | WP_252223030.1 | BRO family protein | - |
| M5E07_RS06085 (M5E07_06085) | 1240682..1240921 | + | 240 | WP_116763258.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1199451..1246442 | 46991 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10568.07 Da Isoelectric Point: 9.9524
>T247935 WP_044738568.1 NZ_CP098732:1235354-1235635 [Acinetobacter tibetensis]
MIKSFKHKGLQAFFQTGTTAGIQAAHSAKLRLILAALHAASTVNDLRTPPNWRLHKLSGNLQDQWSLTVNGNWRVIFKFE
DGDVYIVDYLDYH
MIKSFKHKGLQAFFQTGTTAGIQAAHSAKLRLILAALHAASTVNDLRTPPNWRLHKLSGNLQDQWSLTVNGNWRVIFKFE
DGDVYIVDYLDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|