Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3746465..3747303 | Replicon | chromosome |
| Accession | NZ_CP098731 | ||
| Organism | Stutzerimonas stutzeri strain NRCB010 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A4VQ36 |
| Locus tag | NDR94_RS17600 | Protein ID | WP_011914487.1 |
| Coordinates | 3746465..3746977 (-) | Length | 171 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A4VQ37 |
| Locus tag | NDR94_RS17605 | Protein ID | WP_011914488.1 |
| Coordinates | 3746974..3747303 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDR94_RS17580 (NDR94_17550) | 3741486..3742133 | + | 648 | WP_011914482.1 | hypothetical protein | - |
| NDR94_RS17585 (NDR94_17555) | 3742216..3744396 | + | 2181 | WP_011914483.1 | ATP-binding protein | - |
| NDR94_RS17590 (NDR94_17560) | 3744468..3744839 | + | 372 | WP_011914484.1 | hypothetical protein | - |
| NDR94_RS17595 (NDR94_17565) | 3744894..3745901 | + | 1008 | WP_041755950.1 | WYL domain-containing protein | - |
| NDR94_RS17600 (NDR94_17570) | 3746465..3746977 | - | 513 | WP_011914487.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| NDR94_RS17605 (NDR94_17575) | 3746974..3747303 | - | 330 | WP_011914488.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| NDR94_RS17610 (NDR94_17580) | 3747630..3749849 | - | 2220 | WP_011914489.1 | DEAD/DEAH box helicase | - |
| NDR94_RS17615 (NDR94_17585) | 3749824..3751119 | - | 1296 | WP_014597639.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3740586..3761314 | 20728 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 171 a.a. Molecular weight: 19740.44 Da Isoelectric Point: 9.7787
>T247934 WP_011914487.1 NZ_CP098731:c3746977-3746465 [Stutzerimonas stutzeri]
MSAGKPEPLVIHGWTVFAHPLFLAQIEVLARQVETLKQKDSVGYVKKNASKRLAAIIKLAFDVIPQDPTRPEYRQGGTLG
DDHKHWFRAKFFQQYRLFFRYHAPSKVIVFAWVNDDDTKRAYQSSDDAYRVFRKMLESGHPPDDWDRLLAEAQTESRRME
ESFARAATVQ
MSAGKPEPLVIHGWTVFAHPLFLAQIEVLARQVETLKQKDSVGYVKKNASKRLAAIIKLAFDVIPQDPTRPEYRQGGTLG
DDHKHWFRAKFFQQYRLFFRYHAPSKVIVFAWVNDDDTKRAYQSSDDAYRVFRKMLESGHPPDDWDRLLAEAQTESRRME
ESFARAATVQ
Download Length: 513 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|