Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2361687..2361871 | Replicon | chromosome |
| Accession | NZ_CP098727 | ||
| Organism | Staphylococcus aureus strain SauR3 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | LC189_RS11390 | Protein ID | WP_000482647.1 |
| Coordinates | 2361687..2361794 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2361811..2361871 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LC189_RS11365 (LC189_011365) | 2357059..2357532 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
| LC189_RS11370 (LC189_011370) | 2357655..2358866 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| LC189_RS11375 (LC189_011375) | 2359048..2359707 | - | 660 | WP_000831301.1 | membrane protein | - |
| LC189_RS11380 (LC189_011380) | 2359767..2360909 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
| LC189_RS11385 (LC189_011385) | 2361167..2361553 | + | 387 | WP_000779360.1 | flippase GtxA | - |
| LC189_RS11390 (LC189_011390) | 2361687..2361794 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2361811..2361871 | - | 61 | - | - | Antitoxin |
| LC189_RS11395 (LC189_011395) | 2362501..2364264 | + | 1764 | WP_001064814.1 | ABC transporter ATP-binding protein | - |
| LC189_RS11400 (LC189_011400) | 2364289..2366022 | + | 1734 | WP_000486506.1 | ABC transporter ATP-binding protein | - |
| LC189_RS11405 (LC189_011405) | 2366289..2366420 | + | 132 | WP_223223631.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T247927 WP_000482647.1 NZ_CP098727:2361687-2361794 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT247927 NZ_CP098727:c2361871-2361811 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|