Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 167402..167582 Replicon chromosome
Accession NZ_CP098727
Organism Staphylococcus aureus strain SauR3

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag LC189_RS01025 Protein ID WP_001801861.1
Coordinates 167487..167582 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 167402..167459 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LC189_RS01000 (LC189_001000) 163004..164269 + 1266 WP_000072555.1 restriction endonuclease subunit S -
LC189_RS01005 (LC189_001005) 164308..165162 + 855 WP_224826879.1 DNA adenine methylase -
LC189_RS01010 (LC189_001010) 165140..165649 + 510 WP_224826878.1 hypothetical protein -
LC189_RS01015 (LC189_001015) 165583..166836 + 1254 WP_224826877.1 hypothetical protein -
LC189_RS01020 (LC189_001020) 167266..167364 - 99 Protein_164 hypothetical protein -
- 167402..167459 + 58 - - Antitoxin
LC189_RS01025 (LC189_001025) 167487..167582 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
LC189_RS01030 (LC189_001030) 168034..168480 + 447 WP_224876190.1 DUF1433 domain-containing protein -
LC189_RS01035 (LC189_001035) 168594..169221 + 628 Protein_167 ImmA/IrrE family metallo-endopeptidase -
LC189_RS01040 (LC189_001040) 169353..170105 - 753 WP_000764922.1 staphylococcal enterotoxin type 27 -
LC189_RS01045 (LC189_001045) 170132..170815 - 684 WP_223223630.1 exotoxin beta-grasp domain-containing protein -
LC189_RS01050 (LC189_001050) 170902..171528 - 627 WP_000669025.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk 146041..174087 28046


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T247924 WP_001801861.1 NZ_CP098727:c167582-167487 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT247924 NZ_CP098727:167402-167459 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References