Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 59535..60200 | Replicon | plasmid pYR4 |
| Accession | NZ_CP098725 | ||
| Organism | Yersinia ruckeri strain NVI-10571 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A380S9H4 |
| Locus tag | ND438_RS17370 | Protein ID | WP_038251855.1 |
| Coordinates | 59877..60200 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ND438_RS17365 | Protein ID | WP_004720859.1 |
| Coordinates | 59535..59831 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND438_RS17345 (ND438_17340) | 54832..56757 | - | 1926 | WP_004720847.1 | relaxase/mobilization nuclease domain-containing protein | - |
| ND438_RS17350 (ND438_17345) | 56759..57103 | - | 345 | WP_004720848.1 | plasmid mobilization protein MobA | - |
| ND438_RS17355 (ND438_17350) | 57372..57695 | + | 324 | WP_004720850.1 | hypothetical protein | - |
| ND438_RS17360 (ND438_17355) | 58234..59047 | - | 814 | Protein_55 | DUF932 domain-containing protein | - |
| ND438_RS17365 (ND438_17360) | 59535..59831 | - | 297 | WP_004720859.1 | NadS family protein | Antitoxin |
| ND438_RS17370 (ND438_17365) | 59877..60200 | - | 324 | WP_038251855.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ND438_RS17375 (ND438_17370) | 60352..60585 | + | 234 | WP_038251853.1 | hypothetical protein | - |
| ND438_RS17380 (ND438_17375) | 60593..61090 | - | 498 | WP_126940174.1 | hypothetical protein | - |
| ND438_RS17385 (ND438_17380) | 61087..61446 | - | 360 | WP_126940175.1 | DUF3085 domain-containing protein | - |
| ND438_RS17390 (ND438_17385) | 62205..62915 | - | 711 | WP_126940176.1 | N-6 DNA methylase | - |
| ND438_RS17395 (ND438_17390) | 63061..63207 | - | 147 | WP_126940177.1 | succinate dehydrogenase flavoprotein subunit | - |
| ND438_RS17400 (ND438_17395) | 63293..63649 | - | 357 | WP_126940178.1 | hypothetical protein | - |
| ND438_RS17405 (ND438_17400) | 64403..64603 | - | 201 | WP_126940179.1 | hypothetical protein | - |
| ND438_RS17410 (ND438_17405) | 64646..65152 | - | 507 | WP_126940180.1 | antirestriction protein ArdA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..76483 | 76483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12416.31 Da Isoelectric Point: 8.8371
>T247922 WP_038251855.1 NZ_CP098725:c60200-59877 [Yersinia ruckeri]
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|