Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 67894..68559 | Replicon | plasmid pYR4 |
Accession | NZ_CP098717 | ||
Organism | Yersinia ruckeri strain NVI-11294 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A380S9H4 |
Locus tag | ND011_RS17840 | Protein ID | WP_038251855.1 |
Coordinates | 68236..68559 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ND011_RS17835 | Protein ID | WP_004720859.1 |
Coordinates | 67894..68190 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND011_RS17810 (ND011_17800) | 63191..65116 | - | 1926 | WP_004720847.1 | relaxase/mobilization nuclease domain-containing protein | - |
ND011_RS17815 (ND011_17805) | 65118..65462 | - | 345 | WP_004720848.1 | plasmid mobilization protein MobA | - |
ND011_RS17820 (ND011_17810) | 65731..66054 | + | 324 | WP_004720850.1 | hypothetical protein | - |
ND011_RS17825 (ND011_17815) | 66201..66371 | - | 171 | WP_004720852.1 | DUF5983 family protein | - |
ND011_RS17830 (ND011_17820) | 66593..67406 | - | 814 | Protein_76 | DUF932 domain-containing protein | - |
ND011_RS17835 (ND011_17825) | 67894..68190 | - | 297 | WP_004720859.1 | NadS family protein | Antitoxin |
ND011_RS17840 (ND011_17830) | 68236..68559 | - | 324 | WP_038251855.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ND011_RS17845 (ND011_17835) | 68711..68944 | + | 234 | WP_038251853.1 | hypothetical protein | - |
ND011_RS17850 (ND011_17840) | 68952..69449 | - | 498 | WP_126940174.1 | hypothetical protein | - |
ND011_RS17855 (ND011_17845) | 69446..69805 | - | 360 | WP_126940175.1 | DUF3085 domain-containing protein | - |
ND011_RS17860 (ND011_17850) | 70564..71376 | - | 813 | WP_238692894.1 | N-6 DNA methylase | - |
ND011_RS17865 (ND011_17855) | 71420..71566 | - | 147 | WP_126940177.1 | succinate dehydrogenase flavoprotein subunit | - |
ND011_RS17870 (ND011_17860) | 71652..72008 | - | 357 | WP_126940178.1 | hypothetical protein | - |
ND011_RS17875 (ND011_17865) | 72762..72962 | - | 201 | WP_126940179.1 | hypothetical protein | - |
ND011_RS17880 (ND011_17870) | 73005..73511 | - | 507 | WP_126940180.1 | antirestriction protein ArdA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..115590 | 115590 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12416.31 Da Isoelectric Point: 8.8371
>T247883 WP_038251855.1 NZ_CP098717:c68559-68236 [Yersinia ruckeri]
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|