Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 64694..65359 | Replicon | plasmid pYR4 |
Accession | NZ_CP098715 | ||
Organism | Yersinia ruckeri strain NVI-1176 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A380S9H4 |
Locus tag | ND442_RS17860 | Protein ID | WP_038251855.1 |
Coordinates | 65036..65359 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ND442_RS17855 | Protein ID | WP_004720859.1 |
Coordinates | 64694..64990 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND442_RS17835 (ND442_17835) | 59991..61916 | - | 1926 | WP_004720847.1 | relaxase/mobilization nuclease domain-containing protein | - |
ND442_RS17840 (ND442_17840) | 61918..62262 | - | 345 | WP_004720848.1 | plasmid mobilization protein MobA | - |
ND442_RS17845 (ND442_17845) | 62531..62854 | + | 324 | WP_004720850.1 | hypothetical protein | - |
ND442_RS17850 (ND442_17850) | 63393..64206 | - | 814 | Protein_61 | DUF932 domain-containing protein | - |
ND442_RS17855 (ND442_17855) | 64694..64990 | - | 297 | WP_004720859.1 | NadS family protein | Antitoxin |
ND442_RS17860 (ND442_17860) | 65036..65359 | - | 324 | WP_038251855.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ND442_RS17865 (ND442_17865) | 65511..65744 | + | 234 | WP_038251853.1 | hypothetical protein | - |
ND442_RS17870 (ND442_17870) | 65752..66249 | - | 498 | WP_126940174.1 | hypothetical protein | - |
ND442_RS17875 (ND442_17875) | 66246..66605 | - | 360 | WP_126940175.1 | DUF3085 domain-containing protein | - |
ND442_RS17880 (ND442_17880) | 67364..68176 | - | 813 | WP_238692894.1 | N-6 DNA methylase | - |
ND442_RS17885 (ND442_17885) | 68220..68366 | - | 147 | WP_126940177.1 | succinate dehydrogenase flavoprotein subunit | - |
ND442_RS17890 (ND442_17890) | 68452..68808 | - | 357 | WP_126940178.1 | hypothetical protein | - |
ND442_RS17895 (ND442_17895) | 69562..69762 | - | 201 | WP_126940179.1 | hypothetical protein | - |
ND442_RS17900 (ND442_17900) | 69805..70311 | - | 507 | WP_126940180.1 | antirestriction protein ArdA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..80847 | 80847 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12416.31 Da Isoelectric Point: 8.8371
>T247872 WP_038251855.1 NZ_CP098715:c65359-65036 [Yersinia ruckeri]
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|