Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 58003..58634 Replicon plasmid pYR6
Accession NZ_CP098708
Organism Yersinia ruckeri strain NVI-4570

Toxin (Protein)


Gene name higB Uniprot ID A0A2R4NX45
Locus tag ND447_RS17875 Protein ID WP_049615238.1
Coordinates 58344..58634 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag ND447_RS17870 Protein ID WP_049615233.1
Coordinates 58003..58332 (-) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND447_RS17845 (ND447_17835) 54230..54466 - 237 WP_267262814.1 hypothetical protein -
ND447_RS17850 (ND447_17840) 54774..55337 - 564 WP_267262815.1 helix-turn-helix transcriptional regulator -
ND447_RS17855 (ND447_17845) 55436..55840 - 405 WP_120806768.1 plasmid partitioning/stability family protein -
ND447_RS17860 (ND447_17850) 55847..56824 - 978 WP_267262816.1 plasmid segregation protein ParM -
ND447_RS17865 (ND447_17855) 57081..57581 - 501 WP_265317717.1 hypothetical protein -
ND447_RS17870 (ND447_17860) 58003..58332 - 330 WP_049615233.1 HigA family addiction module antitoxin Antitoxin
ND447_RS17875 (ND447_17865) 58344..58634 - 291 WP_049615238.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ND447_RS17880 (ND447_17870) 58772..59593 - 822 WP_080991164.1 N-6 DNA methylase -
ND447_RS17885 (ND447_17875) 59967..60392 + 426 WP_234049632.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
ND447_RS17890 (ND447_17880) 60392..61648 + 1257 WP_267262817.1 translesion error-prone DNA polymerase V subunit UmuC -
ND447_RS17895 (ND447_17885) 61700..62056 - 357 WP_267262818.1 hypothetical protein -
ND447_RS17900 (ND447_17890) 62106..62333 - 228 WP_145544398.1 hypothetical protein -
ND447_RS17905 (ND447_17895) 62391..63011 - 621 WP_226723006.1 ParA family protein -
ND447_RS17910 (ND447_17900) 63369..63614 - 246 WP_267262819.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..71441 71441


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(3-93)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(7-85)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11538.18 Da        Isoelectric Point: 9.3579

>T247839 WP_049615238.1 NZ_CP098708:c58634-58344 [Yersinia ruckeri]
MIKSFRDKNLELFYMESKRDRAIPATIERQLAKKLDMLAAAHNERDLFIPTSNYYKRLSGQFDGWSSMRVNIQWRLMFQW
KDGYAESIYLDPHQDT

Download         Length: 291 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12630.54 Da        Isoelectric Point: 6.2374

>AT247839 WP_049615233.1 NZ_CP098708:c58332-58003 [Yersinia ruckeri]
MLDTTTREPTTVGEILQEEFLTPLAIGQEELADIMGVTRATVNRLCKGRRRLTVEEATLFSELFETTPEFWLNLQAAHDR
WEAREALQKHKRPPMRPIMEMLGRRISHA

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2R4NX45

Antitoxin

Source ID Structure

References