Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 51385..52050 | Replicon | plasmid pYR4 |
| Accession | NZ_CP098699 | ||
| Organism | Yersinia ruckeri strain NVI-6614 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A380S9H4 |
| Locus tag | ND449_RS17800 | Protein ID | WP_038251855.1 |
| Coordinates | 51727..52050 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ND449_RS17795 | Protein ID | WP_004720859.1 |
| Coordinates | 51385..51681 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND449_RS17775 (ND449_17760) | 46682..48607 | - | 1926 | WP_004720847.1 | relaxase/mobilization nuclease domain-containing protein | - |
| ND449_RS17780 (ND449_17765) | 48609..48953 | - | 345 | WP_004720848.1 | plasmid mobilization protein MobA | - |
| ND449_RS17785 (ND449_17770) | 49222..49545 | + | 324 | WP_004720850.1 | hypothetical protein | - |
| ND449_RS17790 (ND449_17780) | 50084..50897 | - | 814 | Protein_46 | DUF932 domain-containing protein | - |
| ND449_RS17795 (ND449_17785) | 51385..51681 | - | 297 | WP_004720859.1 | NadS family protein | Antitoxin |
| ND449_RS17800 (ND449_17790) | 51727..52050 | - | 324 | WP_038251855.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ND449_RS17805 (ND449_17795) | 52202..52435 | + | 234 | WP_038251853.1 | hypothetical protein | - |
| ND449_RS17810 (ND449_17800) | 52443..52940 | - | 498 | WP_126940174.1 | hypothetical protein | - |
| ND449_RS17815 (ND449_17805) | 52937..53296 | - | 360 | WP_126940175.1 | DUF3085 domain-containing protein | - |
| ND449_RS17820 (ND449_17810) | 54055..54765 | - | 711 | WP_126940176.1 | N-6 DNA methylase | - |
| ND449_RS17825 (ND449_17815) | 54911..55057 | - | 147 | WP_126940177.1 | succinate dehydrogenase flavoprotein subunit | - |
| ND449_RS17830 (ND449_17820) | 55143..55499 | - | 357 | WP_126940178.1 | hypothetical protein | - |
| ND449_RS17835 (ND449_17825) | 56253..56453 | - | 201 | WP_126940179.1 | hypothetical protein | - |
| ND449_RS17840 (ND449_17830) | 56496..57002 | - | 507 | WP_126940180.1 | antirestriction protein ArdA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..80438 | 80438 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12416.31 Da Isoelectric Point: 8.8371
>T247805 WP_038251855.1 NZ_CP098699:c52050-51727 [Yersinia ruckeri]
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
MEYLEFIETPVFSRRRAELLPDDDFRALQEHLLKNHDLGDTISKTGGCKKIRWSREGMGKRGGVRVIYYVITKSGRLYLL
LVYPKNEKDDLTEAEKAVLKSISQQIE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|