Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3177883..3178715 | Replicon | chromosome |
Accession | NZ_CP098611 | ||
Organism | Phormidium yuhuli AB48 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | NEA10_RS13525 | Protein ID | WP_252661176.1 |
Coordinates | 3177883..3178380 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | NEA10_RS13530 | Protein ID | WP_252661178.1 |
Coordinates | 3178383..3178715 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NEA10_RS13510 (NEA10_13510) | 3172926..3174314 | - | 1389 | WP_252661170.1 | BamA/TamA family outer membrane protein | - |
NEA10_RS13515 (NEA10_13515) | 3174463..3176472 | - | 2010 | WP_252661172.1 | ABC transporter ATP-binding protein | - |
NEA10_RS13520 (NEA10_13520) | 3176576..3177706 | - | 1131 | WP_252661174.1 | peptidylprolyl isomerase | - |
NEA10_RS13525 (NEA10_13525) | 3177883..3178380 | - | 498 | WP_252661176.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
NEA10_RS13530 (NEA10_13530) | 3178383..3178715 | - | 333 | WP_252661178.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
NEA10_RS13535 (NEA10_13535) | 3178887..3180716 | - | 1830 | WP_252661180.1 | threonine--tRNA ligase | - |
NEA10_RS13540 (NEA10_13540) | 3180919..3181311 | + | 393 | WP_252661181.1 | YggT family protein | - |
NEA10_RS13545 (NEA10_13545) | 3181365..3182141 | - | 777 | WP_252661183.1 | LemA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 19603.32 Da Isoelectric Point: 9.5181
>T247756 WP_252661176.1 NZ_CP098611:c3178380-3177883 [Phormidium yuhuli AB48]
VSSEQPIIINGWTLFAHPLFLSQVETLVTQVERLRQKDAQGYKRKNVTKRLAAIARLAFEIIPEDPTRPNYRQGSTLGPE
YKHWFRAKFFQQYRLFFRYHQESKIIVLAWVNDETSKRAYDRDTDAYRVFAKMLDQGHPPDDWEALMQEVSQTTERLKKI
LDQEI
VSSEQPIIINGWTLFAHPLFLSQVETLVTQVERLRQKDAQGYKRKNVTKRLAAIARLAFEIIPEDPTRPNYRQGSTLGPE
YKHWFRAKFFQQYRLFFRYHQESKIIVLAWVNDETSKRAYDRDTDAYRVFAKMLDQGHPPDDWEALMQEVSQTTERLKKI
LDQEI
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|