Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2347393..2347982 | Replicon | chromosome |
Accession | NZ_CP098604 | ||
Organism | Xanthomonas hortorum pv. pelargonii strain OSU493 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | NDY25_RS10345 | Protein ID | WP_168959041.1 |
Coordinates | 2347701..2347982 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NDY25_RS10340 | Protein ID | WP_168959042.1 |
Coordinates | 2347393..2347683 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDY25_RS10310 (NDY25_10290) | 2342571..2342903 | + | 333 | WP_168959046.1 | hypothetical protein | - |
NDY25_RS10315 (NDY25_10295) | 2343018..2344172 | - | 1155 | WP_233366566.1 | hypothetical protein | - |
NDY25_RS10320 (NDY25_10300) | 2344207..2344614 | - | 408 | WP_168959045.1 | hypothetical protein | - |
NDY25_RS10325 (NDY25_10305) | 2345026..2345216 | + | 191 | Protein_2002 | hypothetical protein | - |
NDY25_RS10330 (NDY25_10310) | 2345490..2346308 | - | 819 | WP_218974083.1 | AraC family transcriptional regulator | - |
NDY25_RS10335 (NDY25_10315) | 2346527..2347270 | + | 744 | WP_168959043.1 | SDR family oxidoreductase | - |
NDY25_RS10340 (NDY25_10320) | 2347393..2347683 | - | 291 | WP_168959042.1 | HigA family addiction module antitoxin | Antitoxin |
NDY25_RS10345 (NDY25_10325) | 2347701..2347982 | - | 282 | WP_168959041.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NDY25_RS10350 (NDY25_10330) | 2348196..2349251 | - | 1056 | WP_168959040.1 | virulence RhuM family protein | - |
NDY25_RS10355 (NDY25_10335) | 2349390..2349677 | - | 288 | WP_256627920.1 | ATP-dependent RecD-like DNA helicase | - |
NDY25_RS10360 (NDY25_10340) | 2349761..2351794 | - | 2034 | WP_256627921.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11056.76 Da Isoelectric Point: 9.7972
>T247746 WP_168959041.1 NZ_CP098604:c2347982-2347701 [Xanthomonas hortorum pv. pelargonii]
MIRSFVDKEAEKIWLGERSRRLPADIQPVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWLGERSRRLPADIQPVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|