Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 144370..144955 | Replicon | plasmid pCl107 |
Accession | NZ_CP098522 | ||
Organism | Acinetobacter baumannii strain Cl107 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7S7BY50 |
Locus tag | NDN18_RS20135 | Protein ID | WP_000897311.1 |
Coordinates | 144370..144690 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NDN18_RS20140 | Protein ID | WP_255879317.1 |
Coordinates | 144683..144955 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDN18_RS20115 (NDN18_20110) | 140176..140505 | + | 330 | WP_000506885.1 | DUF4236 domain-containing protein | - |
NDN18_RS20120 (NDN18_20115) | 140777..142009 | - | 1233 | WP_001255535.1 | ATP-binding protein | - |
NDN18_RS20125 (NDN18_20120) | 142267..142704 | - | 438 | Protein_130 | IS3 family transposase | - |
NDN18_RS20130 (NDN18_20125) | 142781..143692 | + | 912 | WP_195201764.1 | IS5-like element IS17 family transposase | - |
NDN18_RS20135 (NDN18_20130) | 144370..144690 | + | 321 | WP_000897311.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NDN18_RS20140 (NDN18_20135) | 144683..144955 | + | 273 | WP_255879317.1 | NadS family protein | Antitoxin |
NDN18_RS20145 (NDN18_20140) | 145025..146114 | - | 1090 | Protein_134 | IS4-like element ISAba1 family transposase | - |
NDN18_RS20150 (NDN18_20145) | 146380..146451 | + | 72 | WP_255879369.1 | DUF2971 domain-containing protein | - |
NDN18_RS20155 (NDN18_20150) | 146603..146977 | + | 375 | WP_255879319.1 | hypothetical protein | - |
NDN18_RS20160 (NDN18_20155) | 147080..147336 | + | 257 | Protein_137 | IS3 family transposase | - |
NDN18_RS20165 (NDN18_20160) | 147484..147696 | + | 213 | WP_001123161.1 | hypothetical protein | - |
NDN18_RS20170 (NDN18_20165) | 148022..148879 | - | 858 | WP_000609033.1 | LysR family transcriptional regulator | - |
NDN18_RS20175 (NDN18_20170) | 148876..149883 | - | 1008 | WP_005071472.1 | phosphonate dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sul2 / tet(B) / aph(6)-Id / aph(3'')-Ib / aac(3)-IIa / aac(6')-Ian | - | 1..198716 | 198716 | |
- | inside | IScluster/Tn | - | - | 142267..147325 | 5058 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12214.03 Da Isoelectric Point: 7.9500
>T247722 WP_000897311.1 NZ_CP098522:144370-144690 [Acinetobacter baumannii]
MLFIETSIFTKQIKELVTDEEYRQLQQDLLIQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETSILRQLVKEQFNG
MLFIETSIFTKQIKELVTDEEYRQLQQDLLIQPDKGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETSILRQLVKEQFNG
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|