Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41558..41748 | Replicon | chromosome |
| Accession | NZ_CP098500 | ||
| Organism | Serratia symbiotica strain Pl-LLN | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | M5J15_RS00280 | Protein ID | WP_252748145.1 |
| Coordinates | 41599..41748 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 41558..41588 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5J15_RS00245 (M5J15_00245) | 36599..36910 | + | 312 | WP_252748141.1 | hypothetical protein | - |
| M5J15_RS00250 (M5J15_00250) | 37161..37964 | + | 804 | Protein_49 | DNA replication protein | - |
| M5J15_RS00255 (M5J15_00255) | 37954..39132 | + | 1179 | WP_252749221.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| M5J15_RS00260 (M5J15_00260) | 39156..39464 | + | 309 | WP_252748142.1 | hypothetical protein | - |
| M5J15_RS00265 (M5J15_00265) | 39457..39606 | + | 150 | WP_252747551.1 | hypothetical protein | - |
| M5J15_RS00270 (M5J15_00270) | 39844..40101 | + | 258 | WP_252748143.1 | hypothetical protein | - |
| M5J15_RS16850 | 40805..40939 | - | 135 | WP_284700487.1 | hypothetical protein | - |
| M5J15_RS00275 (M5J15_00275) | 41032..41409 | + | 378 | WP_252748144.1 | antiterminator Q family protein | - |
| - | 41558..41588 | - | 31 | - | - | Antitoxin |
| M5J15_RS00280 (M5J15_00280) | 41599..41748 | + | 150 | WP_252748145.1 | Hok/Gef family protein | Toxin |
| M5J15_RS00285 (M5J15_00285) | 42170..42463 | + | 294 | WP_252748146.1 | Bro-N domain-containing protein | - |
| M5J15_RS00290 (M5J15_00290) | 43072..43667 | + | 596 | Protein_58 | hypothetical protein | - |
| M5J15_RS00295 (M5J15_00295) | 43623..43769 | - | 147 | WP_162835900.1 | hypothetical protein | - |
| M5J15_RS00300 (M5J15_00300) | 43928..44272 | + | 345 | WP_252748147.1 | hypothetical protein | - |
| M5J15_RS00305 (M5J15_00305) | 44362..44457 | + | 96 | WP_252749222.1 | phage holin family protein | - |
| M5J15_RS00310 (M5J15_00310) | 44576..45001 | + | 426 | WP_252748148.1 | lysozyme | - |
| M5J15_RS00315 (M5J15_00315) | 44998..45411 | + | 414 | WP_252748149.1 | lysis system i-spanin subunit Rz | - |
| M5J15_RS00320 (M5J15_00320) | 45858..46370 | + | 513 | Protein_64 | DUF1441 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 106..64179 | 64073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5394.45 Da Isoelectric Point: 7.9860
>T247706 WP_252748145.1 NZ_CP098500:41599-41748 [Serratia symbiotica]
MKQQMAILIATTVVAAAIAVTLVTRKDLCEVRIRTGQAEVAVFMDYEPK
MKQQMAILIATTVVAAAIAVTLVTRKDLCEVRIRTGQAEVAVFMDYEPK
Download Length: 150 bp
Antitoxin
Download Length: 31 bp
>AT247706 NZ_CP098500:c41588-41558 [Serratia symbiotica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCT
CCTTGCCTTTCGGCACGTAAGAGGCTAACCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
