Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4632443..4633045 | Replicon | chromosome |
| Accession | NZ_CP098486 | ||
| Organism | Enterobacter hormaechei subsp. hormaechei strain ECC33 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A155DUZ6 |
| Locus tag | NDJ97_RS22175 | Protein ID | WP_022649837.1 |
| Coordinates | 4632734..4633045 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NDJ97_RS22170 | Protein ID | WP_022649836.1 |
| Coordinates | 4632443..4632733 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDJ97_RS22155 (NDJ97_22150) | 4629941..4630843 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
| NDJ97_RS22160 (NDJ97_22155) | 4630840..4631475 | + | 636 | WP_006808711.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NDJ97_RS22165 (NDJ97_22160) | 4631472..4632401 | + | 930 | WP_022649835.1 | formate dehydrogenase accessory protein FdhE | - |
| NDJ97_RS22170 (NDJ97_22165) | 4632443..4632733 | - | 291 | WP_022649836.1 | NadS family protein | Antitoxin |
| NDJ97_RS22175 (NDJ97_22170) | 4632734..4633045 | - | 312 | WP_022649837.1 | hypothetical protein | Toxin |
| NDJ97_RS22180 (NDJ97_22175) | 4633194..4634135 | - | 942 | WP_022649838.1 | fatty acid biosynthesis protein FabY | - |
| NDJ97_RS22185 (NDJ97_22180) | 4634180..4634617 | - | 438 | WP_022649839.1 | D-aminoacyl-tRNA deacylase | - |
| NDJ97_RS22190 (NDJ97_22185) | 4634614..4635495 | - | 882 | WP_022649840.1 | virulence factor BrkB family protein | - |
| NDJ97_RS22195 (NDJ97_22190) | 4635489..4636088 | - | 600 | WP_022649841.1 | glucose-1-phosphatase | - |
| NDJ97_RS22200 (NDJ97_22195) | 4636207..4637007 | - | 801 | WP_022649842.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NDJ97_RS22205 (NDJ97_22200) | 4637042..4637938 | - | 897 | WP_022649843.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12148.13 Da Isoelectric Point: 9.4455
>T247702 WP_022649837.1 NZ_CP098486:c4633045-4632734 [Enterobacter hormaechei subsp. hormaechei]
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNTGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPDYGDLIQNTGGLRKIRWLAGGKGKRSGVRVIYFHRTRECEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10699.21 Da Isoelectric Point: 10.5888
>AT247702 WP_022649836.1 NZ_CP098486:c4632733-4632443 [Enterobacter hormaechei subsp. hormaechei]
MDKALFERLTQSIAQINEIAEGQREPSRTFQIDAMKIKEIRQASGLSQSKFANLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVIPALTQ
MDKALFERLTQSIAQINEIAEGQREPSRTFQIDAMKIKEIRQASGLSQSKFANLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVIPALTQ
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|