Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 30480..31210 | Replicon | chromosome |
| Accession | NZ_CP098486 | ||
| Organism | Enterobacter hormaechei subsp. hormaechei strain ECC33 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A155SSD8 |
| Locus tag | NDJ97_RS00155 | Protein ID | WP_022646552.1 |
| Coordinates | 30480..30794 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NDJ97_RS00160 | Protein ID | WP_032622105.1 |
| Coordinates | 30794..31210 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDJ97_RS00130 (NDJ97_00130) | 26146..27231 | + | 1086 | Protein_25 | cellulase family glycosylhydrolase | - |
| NDJ97_RS00135 (NDJ97_00135) | 27137..28321 | - | 1185 | WP_022646548.1 | multidrug efflux MFS transporter EmrD | - |
| NDJ97_RS00140 (NDJ97_00140) | 28497..29330 | - | 834 | WP_022646549.1 | DMT family transporter | - |
| NDJ97_RS00145 (NDJ97_00145) | 29393..29839 | - | 447 | WP_022646550.1 | GNAT family N-acetyltransferase | - |
| NDJ97_RS00150 (NDJ97_00150) | 29904..29993 | - | 90 | WP_022646551.1 | type I toxin-antitoxin system toxin TisB | - |
| NDJ97_RS00155 (NDJ97_00155) | 30480..30794 | + | 315 | WP_022646552.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NDJ97_RS00160 (NDJ97_00160) | 30794..31210 | + | 417 | WP_032622105.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NDJ97_RS00165 (NDJ97_00165) | 31357..31455 | + | 99 | WP_057979964.1 | ilvB operon leader peptide IvbL | - |
| NDJ97_RS00170 (NDJ97_00170) | 31685..33373 | + | 1689 | WP_022646554.1 | acetolactate synthase large subunit | - |
| NDJ97_RS00175 (NDJ97_00175) | 33377..33664 | + | 288 | WP_015570113.1 | acetolactate synthase small subunit | - |
| NDJ97_RS00180 (NDJ97_00180) | 33790..34383 | + | 594 | WP_022646555.1 | transcriptional regulator UhpA | - |
| NDJ97_RS00185 (NDJ97_00185) | 34380..35885 | + | 1506 | WP_022646556.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12441.55 Da Isoelectric Point: 10.1989
>T247692 WP_022646552.1 NZ_CP098486:30480-30794 [Enterobacter hormaechei subsp. hormaechei]
MHLISMKAILDAVSQFPQYREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVSQFPQYREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15348.91 Da Isoelectric Point: 5.6761
>AT247692 WP_032622105.1 NZ_CP098486:30794-31210 [Enterobacter hormaechei subsp. hormaechei]
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANRPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISHYEANRPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|