Detailed information of TA system TA247635

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 9683..10109
• Replicon: plasmid unnamed1
• Accession: NZ_CP098439
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M9193_RS23145
• Protein ID: WP_001372321.1
• Coordinates: 9984..10109 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	9683..9907 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M9193_RS23105 (4774)	4774..5055	+	282	WP_072277694.1	hypothetical protein	-
M9193_RS23110 (5296)	5296..5502	+	207	WP_000547975.1	hypothetical protein	-
M9193_RS23115 (5528)	5528..6067	+	540	WP_000290841.1	single-stranded DNA-binding protein	-
M9193_RS23120 (6130)	6130..6363	+	234	WP_000005990.1	DUF905 family protein	-
M9193_RS23125 (6429)	6429..8452	+	2024	Protein_11	ParB/RepB/Spo0J family partition protein	-
M9193_RS23130 (8521)	8521..8955	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M9193_RS23135 (8952)	8952..9671	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
- (9683)	9683..9907	+	225	NuclAT_0	-	Antitoxin
- (9683)	9683..9907	+	225	NuclAT_0	-	Antitoxin
- (9683)	9683..9907	+	225	NuclAT_0	-	Antitoxin
- (9683)	9683..9907	+	225	NuclAT_0	-	Antitoxin
M9193_RS23140 (9893)	9893..10042	+	150	Protein_14	plasmid maintenance protein Mok	-
M9193_RS23145 (9984)	9984..10109	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M9193_RS23150 (10428)	10428..10724	-	297	Protein_16	hypothetical protein	-
M9193_RS23155 (11024)	11024..11320	+	297	WP_001272251.1	hypothetical protein	-
M9193_RS23160 (11431)	11431..12252	+	822	WP_001234445.1	DUF932 domain-containing protein	-
M9193_RS23165 (12549)	12549..13139	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
M9193_RS23170 (13474)	13474..13857	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M9193_RS23175 (14051)	14051..14722	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
M9193_RS23180 (14859)	14859..15086	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / sitABCD	iucA / iucB / iucC / iucD / iutA	1..109442	109442

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T247635 WP_001372321.1 NZ_CP098439:9984-10109 [Salmonella enterica subsp. enterica serovar Typhimurium]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT247635 NZ_CP098439:9683-9907 [Salmonella enterica subsp. enterica serovar Typhimurium]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin