Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4628562..4629316 | Replicon | chromosome |
| Accession | NZ_CP098438 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | M9193_RS22300 | Protein ID | WP_000558166.1 |
| Coordinates | 4628562..4628873 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M9193_RS22305 | Protein ID | WP_001259011.1 |
| Coordinates | 4628870..4629316 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9193_RS22270 (4624220) | 4624220..4625122 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| M9193_RS22275 (4625119) | 4625119..4625754 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M9193_RS22280 (4625751) | 4625751..4626680 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| M9193_RS22285 (4626727) | 4626727..4627017 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| M9193_RS22290 (4627018) | 4627018..4627329 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| M9193_RS22295 (4627547) | 4627547..4628476 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| M9193_RS22300 (4628562) | 4628562..4628873 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| M9193_RS22305 (4628870) | 4628870..4629316 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| M9193_RS22310 (4629331) | 4629331..4630272 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| M9193_RS22315 (4630317) | 4630317..4630754 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| M9193_RS22320 (4630751) | 4630751..4631623 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| M9193_RS22325 (4631617) | 4631617..4632216 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| M9193_RS22330 (4632407) | 4632407..4633210 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| M9193_RS22335 (4633244) | 4633244..4634140 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T247634 WP_000558166.1 NZ_CP098438:4628562-4628873 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT247634 WP_001259011.1 NZ_CP098438:4628870-4629316 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|