Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4304947..4305728 | Replicon | chromosome |
Accession | NZ_CP098438 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | M9193_RS20850 | Protein ID | WP_000626099.1 |
Coordinates | 4304947..4305438 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | M9193_RS20855 | Protein ID | WP_001110452.1 |
Coordinates | 4305435..4305728 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9193_RS20815 (4300943) | 4300943..4301518 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
M9193_RS20825 (4301789) | 4301789..4301866 | - | 78 | Protein_4070 | helix-turn-helix domain-containing protein | - |
M9193_RS20830 (4301957) | 4301957..4302289 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
M9193_RS20835 (4302361) | 4302361..4302738 | + | 378 | WP_000916345.1 | EthD family reductase | - |
M9193_RS20840 (4303770) | 4303770..4303844 | + | 75 | Protein_4073 | porin family protein | - |
M9193_RS20845 (4303947) | 4303947..4304699 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
M9193_RS20850 (4304947) | 4304947..4305438 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
M9193_RS20855 (4305435) | 4305435..4305728 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
M9193_RS20860 (4306045) | 4306045..4306266 | + | 222 | WP_001576552.1 | hypothetical protein | - |
M9193_RS20865 (4306531) | 4306531..4307406 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
M9193_RS20870 (4307403) | 4307403..4307690 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
M9193_RS20875 (4307713) | 4307713..4307928 | + | 216 | WP_001595136.1 | hypothetical protein | - |
M9193_RS20880 (4307936) | 4307936..4308205 | + | 270 | WP_010989096.1 | hypothetical protein | - |
M9193_RS20885 (4308414) | 4308414..4308872 | - | 459 | WP_000502119.1 | IS200/IS605-like element IS200F family transposase | - |
M9193_RS20890 (4309211) | 4309211..4310116 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4308414..4308872 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T247632 WP_000626099.1 NZ_CP098438:c4305438-4304947 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT247632 WP_001110452.1 NZ_CP098438:c4305728-4305435 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |