Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2426626..2427148 | Replicon | chromosome |
Accession | NZ_CP098438 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | M9193_RS11720 | Protein ID | WP_000221343.1 |
Coordinates | 2426864..2427148 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | M9193_RS11715 | Protein ID | WP_000885424.1 |
Coordinates | 2426626..2426874 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9193_RS11690 (2421842) | 2421842..2423308 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
M9193_RS11695 (2424116) | 2424116..2424830 | + | 715 | Protein_2289 | helix-turn-helix domain-containing protein | - |
M9193_RS11700 (2424886) | 2424886..2425794 | - | 909 | WP_010989018.1 | hypothetical protein | - |
M9193_RS11705 (2425937) | 2425937..2426269 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
M9193_RS11710 (2426259) | 2426259..2426474 | - | 216 | WP_000206207.1 | hypothetical protein | - |
M9193_RS11715 (2426626) | 2426626..2426874 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M9193_RS11720 (2426864) | 2426864..2427148 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9193_RS11725 (2427319) | 2427319..2427708 | + | 390 | WP_000194089.1 | RidA family protein | - |
M9193_RS11730 (2427760) | 2427760..2428839 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
M9193_RS11735 (2429032) | 2429032..2429520 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
M9193_RS11740 (2429565) | 2429565..2431073 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2421845..2433930 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T247626 WP_000221343.1 NZ_CP098438:2426864-2427148 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |