Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 3049885..3050417 | Replicon | chromosome |
Accession | NZ_CP098437 | ||
Organism | Streptomyces lydicamycinicus strain MMS22-DDSA8 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | NCG97_RS13630 | Protein ID | WP_251084126.1 |
Coordinates | 3049885..3050139 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | NCG97_RS13635 | Protein ID | WP_251084127.1 |
Coordinates | 3050136..3050417 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCG97_RS13620 (NCG97_13615) | 3045644..3046045 | + | 402 | WP_251084124.1 | hypothetical protein | - |
NCG97_RS13625 (NCG97_13620) | 3046325..3049840 | + | 3516 | WP_251084125.1 | ATP-binding protein | - |
NCG97_RS13630 (NCG97_13625) | 3049885..3050139 | - | 255 | WP_251084126.1 | Txe/YoeB family addiction module toxin | Toxin |
NCG97_RS13635 (NCG97_13630) | 3050136..3050417 | - | 282 | WP_251084127.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NCG97_RS13640 (NCG97_13635) | 3050606..3051694 | - | 1089 | WP_042148097.1 | redox-regulated ATPase YchF | - |
NCG97_RS13645 (NCG97_13640) | 3052380..3052532 | - | 153 | WP_158894227.1 | hypothetical protein | - |
NCG97_RS13650 (NCG97_13645) | 3052613..3053506 | - | 894 | WP_042148094.1 | ROK family protein | - |
NCG97_RS13655 (NCG97_13650) | 3053592..3054611 | - | 1020 | WP_063770768.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10098.61 Da Isoelectric Point: 8.4390
>T247615 WP_251084126.1 NZ_CP098437:c3050139-3049885 [Streptomyces lydicamycinicus]
VRLVFEDQGWEDYTSWLKNDRKMLTRINKLIEDVKRDPFEGIGKPEPLKYHLPGAWSRRIDDEHRLVYLVTGKEIVILAA
RYHY
VRLVFEDQGWEDYTSWLKNDRKMLTRINKLIEDVKRDPFEGIGKPEPLKYHLPGAWSRRIDDEHRLVYLVTGKEIVILAA
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|