Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 19234..19448 | Replicon | plasmid pCQ025-3 |
Accession | NZ_CP098421 | ||
Organism | Enterococcus faecalis strain CQ025 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | NAG09_RS14865 | Protein ID | WP_002360667.1 |
Coordinates | 19234..19344 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 19384..19448 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG09_RS14825 | 14315..14545 | - | 231 | WP_002362431.1 | hypothetical protein | - |
NAG09_RS14830 | 14749..15369 | + | 621 | WP_161971471.1 | recombinase family protein | - |
NAG09_RS14835 | 15386..15550 | + | 165 | WP_250652966.1 | hypothetical protein | - |
NAG09_RS14845 | 16954..17187 | + | 234 | WP_002394799.1 | hypothetical protein | - |
NAG09_RS14850 | 17347..17601 | - | 255 | WP_002394800.1 | hypothetical protein | - |
NAG09_RS14855 | 17718..18386 | - | 669 | WP_002403283.1 | CPBP family intramembrane metalloprotease | - |
NAG09_RS14860 | 18422..18739 | - | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
NAG09_RS14865 | 19234..19344 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 19384..19448 | - | 65 | - | - | Antitoxin |
NAG09_RS14870 | 19584..19883 | + | 300 | WP_010817802.1 | hypothetical protein | - |
NAG09_RS14875 | 20668..21210 | - | 543 | WP_086321354.1 | hypothetical protein | - |
NAG09_RS14880 | 21220..22071 | - | 852 | WP_002362419.1 | ParA family protein | - |
NAG09_RS14885 | 22734..23750 | + | 1017 | WP_033593833.1 | replication initiator protein A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrG / aph(3')-III / erm(B) | - | 1..59669 | 59669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T247610 WP_002360667.1 NZ_CP098421:19234-19344 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT247610 NZ_CP098421:c19448-19384 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|