Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2831638..2831974 | Replicon | chromosome |
| Accession | NZ_CP098418 | ||
| Organism | Enterococcus faecalis strain CQ025 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | NAG09_RS13680 | Protein ID | WP_002396786.1 |
| Coordinates | 2831638..2831781 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2831925..2831974 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG09_RS13665 (2827354) | 2827354..2827986 | - | 633 | WP_002358972.1 | RloB family protein | - |
| NAG09_RS13670 (2827995) | 2827995..2829290 | - | 1296 | WP_002410675.1 | ATP-binding protein | - |
| NAG09_RS13675 (2829752) | 2829752..2831368 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
| NAG09_RS13680 (2831638) | 2831638..2831781 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| - (2831925) | 2831925..2831974 | + | 50 | NuclAT_8 | - | Antitoxin |
| - (2831713) | 2831713..2831975 | - | 263 | NuclAT_7 | - | - |
| NAG09_RS13685 (2831976) | 2831976..2836667 | - | 4692 | WP_250652880.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T247605 WP_002396786.1 NZ_CP098418:2831638-2831781 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT247605 NZ_CP098418:2831925-2831974 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|