Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
| Location | 1389954..1390518 | Replicon | chromosome |
| Accession | NZ_CP098411 | ||
| Organism | Lacticaseibacillus paracasei strain 401 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | K6S2P8 |
| Locus tag | NCY29_RS06775 | Protein ID | WP_003602097.1 |
| Coordinates | 1390216..1390518 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | K6SLT0 |
| Locus tag | NCY29_RS06770 | Protein ID | WP_003570051.1 |
| Coordinates | 1389954..1390223 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCY29_RS06740 (NCY29_06740) | 1384959..1385846 | - | 888 | WP_063558064.1 | ABC transporter ATP-binding protein | - |
| NCY29_RS06745 (NCY29_06745) | 1386043..1387269 | - | 1227 | WP_250786116.1 | hypothetical protein | - |
| NCY29_RS06750 (NCY29_06750) | 1387467..1387871 | + | 405 | WP_063558066.1 | MerR family transcriptional regulator | - |
| NCY29_RS06755 (NCY29_06755) | 1387864..1388190 | + | 327 | WP_063558067.1 | YrdB family protein | - |
| NCY29_RS06760 (NCY29_06760) | 1388253..1388882 | + | 630 | Protein_1311 | DUF2399 domain-containing protein | - |
| NCY29_RS06765 (NCY29_06765) | 1388927..1389580 | + | 654 | WP_063558068.1 | N-acetyltransferase | - |
| NCY29_RS06770 (NCY29_06770) | 1389954..1390223 | + | 270 | WP_003570051.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NCY29_RS06775 (NCY29_06775) | 1390216..1390518 | + | 303 | WP_003602097.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NCY29_RS06780 (NCY29_06780) | 1390857..1391000 | + | 144 | WP_162259784.1 | hypothetical protein | - |
| NCY29_RS06785 (NCY29_06785) | 1391227..1391814 | + | 588 | WP_063558069.1 | hypothetical protein | - |
| NCY29_RS06790 (NCY29_06790) | 1392050..1394227 | + | 2178 | WP_063558070.1 | Tex family protein | - |
| NCY29_RS06795 (NCY29_06795) | 1394652..1395209 | - | 558 | WP_063558071.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1372809..1409872 | 37063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11442.21 Da Isoelectric Point: 9.9697
>T247587 WP_003602097.1 NZ_CP098411:1390216-1390518 [Lacticaseibacillus paracasei]
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELHVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLGK
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELHVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLGK
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K6S2P8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2BRK6 |