Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 244060..244650 | Replicon | chromosome |
Accession | NZ_CP098408 | ||
Organism | Alcaligenes sp. DN25 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NBV64_RS01080 | Protein ID | WP_250756474.1 |
Coordinates | 244354..244650 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | NBV64_RS01075 | Protein ID | WP_250756473.1 |
Coordinates | 244060..244344 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBV64_RS01060 (NBV64_01060) | 239870..241117 | + | 1248 | WP_009460169.1 | D-amino acid dehydrogenase | - |
NBV64_RS01065 (NBV64_01065) | 241309..242319 | - | 1011 | WP_250756471.1 | acyltransferase family protein | - |
NBV64_RS01070 (NBV64_01070) | 242598..243965 | + | 1368 | WP_250756472.1 | DNA recombination protein RmuC | - |
NBV64_RS01075 (NBV64_01075) | 244060..244344 | - | 285 | WP_250756473.1 | HigA family addiction module antitoxin | Antitoxin |
NBV64_RS01080 (NBV64_01080) | 244354..244650 | - | 297 | WP_250756474.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBV64_RS01085 (NBV64_01085) | 244785..247334 | - | 2550 | WP_250756475.1 | EAL domain-containing protein | - |
NBV64_RS01090 (NBV64_01090) | 247527..247805 | + | 279 | WP_009460160.1 | acylphosphatase | - |
NBV64_RS01095 (NBV64_01095) | 247970..248863 | + | 894 | WP_026483806.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11092.48 Da Isoelectric Point: 9.3459
>T247584 WP_250756474.1 NZ_CP098408:c244650-244354 [Alcaligenes sp. DN25]
MIKSFRHKGLQAYFETGSKSGIQAKHAVRLQIQLTALHAATQAEDMNAPGWKLHKLSGKNPKGQSVQDHYTISVSGNWRL
TFYFEGEDAVLVDYQDYH
MIKSFRHKGLQAYFETGSKSGIQAKHAVRLQIQLTALHAATQAEDMNAPGWKLHKLSGKNPKGQSVQDHYTISVSGNWRL
TFYFEGEDAVLVDYQDYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|