Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe(toxin) |
| Location | 737581..738113 | Replicon | chromosome |
| Accession | NZ_CP098403 | ||
| Organism | Lactobacillus kefiranofaciens subsp. kefirgranum strain HL1 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | A0A656YA18 |
| Locus tag | MU859_RS03845 | Protein ID | WP_013854119.1 |
| Coordinates | 737581..737850 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A656Y9W5 |
| Locus tag | MU859_RS03850 | Protein ID | WP_013854120.1 |
| Coordinates | 737847..738113 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MU859_RS03820 (MU859_03820) | 732587..733216 | - | 630 | WP_054640431.1 | Crp/Fnr family transcriptional regulator | - |
| MU859_RS03825 (MU859_03825) | 733235..733786 | - | 552 | WP_013854115.1 | DNA-binding protein | - |
| MU859_RS03830 (MU859_03830) | 733786..734016 | - | 231 | WP_013854116.1 | cation transporter | - |
| MU859_RS03835 (MU859_03835) | 734039..735940 | - | 1902 | WP_188891291.1 | heavy metal translocating P-type ATPase | - |
| MU859_RS03840 (MU859_03840) | 736058..737395 | - | 1338 | WP_025084196.1 | MATE family efflux transporter | - |
| MU859_RS03845 (MU859_03845) | 737581..737850 | - | 270 | WP_013854119.1 | Txe/YoeB family addiction module toxin | Toxin |
| MU859_RS03850 (MU859_03850) | 737847..738113 | - | 267 | WP_013854120.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MU859_RS03855 (MU859_03855) | 738364..739227 | - | 864 | WP_056941350.1 | alpha/beta hydrolase | - |
| MU859_RS03860 (MU859_03860) | 739224..740393 | - | 1170 | WP_013854123.1 | MalY/PatB family protein | - |
| MU859_RS03865 (MU859_03865) | 740399..741292 | - | 894 | WP_013854124.1 | DUF3737 family protein | - |
| MU859_RS03870 (MU859_03870) | 741351..741668 | - | 318 | WP_025084192.1 | carboxymuconolactone decarboxylase family protein | - |
| MU859_RS03875 (MU859_03875) | 741678..742093 | - | 416 | Protein_731 | cupin domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10617.35 Da Isoelectric Point: 10.4670
>T247582 WP_013854119.1 NZ_CP098403:c737850-737581 [Lactobacillus kefiranofaciens subsp. kefirgranum]
MILKYHGRIKNSAKPDLKKIKRSNLKDNFQDIIDQLKKDPYKKNQGFEKLEPPILGKYSRRINIKHRVVYTVDDVNKIVS
IYSAWSHYE
MILKYHGRIKNSAKPDLKKIKRSNLKDNFQDIIDQLKKDPYKKNQGFEKLEPPILGKYSRRINIKHRVVYTVDDVNKIVS
IYSAWSHYE
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656YA18 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656Y9W5 |