Detailed information of TA system TA247561

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 111993..112419
• Replicon: plasmid p52977-166.3
• Accession: NZ_CP098354
• Organism: Klebsiella pneumoniae strain 52977_A1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NB671_RS28570
• Protein ID: WP_096937776.1
• Coordinates: 111993..112118 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	112195..112419 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NB671_RS28535 (107166)	107166..107567	-	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-
NB671_RS28540 (107660)	107660..108349	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NB671_RS28545 (108536)	108536..108919	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NB671_RS28550 (109252)	109252..109842	+	591	WP_279947734.1	transglycosylase SLT domain-containing protein	-
NB671_RS28555 (110139)	110139..110960	-	822	WP_001234487.1	DUF932 domain-containing protein	-
NB671_RS28560 (111071)	111071..111367	-	297	WP_001272245.1	hypothetical protein	-
NB671_RS28565 (111419)	111419..111692	+	274	Protein_113	hypothetical protein	-
NB671_RS28570 (111993)	111993..112118	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
NB671_RS28575 (112060)	112060..112209	-	150	Protein_115	plasmid maintenance protein Mok	-
- (112195)	112195..112419	-	225	NuclAT_0	-	Antitoxin
- (112195)	112195..112419	-	225	NuclAT_0	-	Antitoxin
- (112195)	112195..112419	-	225	NuclAT_0	-	Antitoxin
- (112195)	112195..112419	-	225	NuclAT_0	-	Antitoxin
NB671_RS28580 (112388)	112388..113150	-	763	Protein_116	plasmid SOS inhibition protein A	-
NB671_RS28585 (113147)	113147..113581	-	435	WP_000845962.1	conjugation system SOS inhibitor PsiB	-
NB671_RS28590 (113650)	113650..115614	-	1965	WP_001593049.1	ParB/RepB/Spo0J family partition protein	-
NB671_RS28595 (115673)	115673..115906	-	234	WP_000005985.1	DUF905 family protein	-
NB671_RS28600 (115964)	115964..116503	-	540	WP_001593051.1	single-stranded DNA-binding protein	-
NB671_RS28605 (116529)	116529..116735	-	207	WP_000547969.1	hypothetical protein	-
NB671_RS28610 (116805)	116805..116885	+	81	Protein_122	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..166337	166337
	-	flank	IS/Tn	-	-	117056..118027	971

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T247561 WP_096937776.1 NZ_CP098354:c112118-111993 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT247561 NZ_CP098354:c112419-112195 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin