Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72210..72464 | Replicon | plasmid p52977-166.3 |
| Accession | NZ_CP098354 | ||
| Organism | Klebsiella pneumoniae strain 52977_A1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NB671_RS28340 | Protein ID | WP_001312851.1 |
| Coordinates | 72210..72359 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 72403..72464 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB671_RS28305 (68117) | 68117..68479 | - | 363 | WP_000783215.1 | arsenite efflux transporter metallochaperone ArsD | - |
| NB671_RS28310 (68527) | 68527..68880 | - | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| NB671_RS28315 (70038) | 70038..70895 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NB671_RS28320 (70888) | 70888..71370 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NB671_RS28325 (71363) | 71363..71410 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NB671_RS28330 (71401) | 71401..71652 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NB671_RS28335 (71669) | 71669..71926 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NB671_RS28340 (72210) | 72210..72359 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (72403) | 72403..72464 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (72403) | 72403..72464 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (72403) | 72403..72464 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (72403) | 72403..72464 | + | 62 | NuclAT_1 | - | Antitoxin |
| NB671_RS28345 (72720) | 72720..72794 | - | 75 | Protein_69 | endonuclease | - |
| NB671_RS28355 (74742) | 74742..74954 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NB671_RS28360 (75090) | 75090..75650 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NB671_RS28365 (75753) | 75753..76613 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NB671_RS28370 (76672) | 76672..77418 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..166337 | 166337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T247556 WP_001312851.1 NZ_CP098354:c72359-72210 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT247556 NZ_CP098354:72403-72464 [Klebsiella pneumoniae]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
