Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 736486..737261 | Replicon | chromosome |
Accession | NZ_CP098347 | ||
Organism | Klebsiella pneumoniae strain 52984_A8 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | NB669_RS03680 | Protein ID | WP_004150910.1 |
Coordinates | 736776..737261 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NB669_RS03675 | Protein ID | WP_004150912.1 |
Coordinates | 736486..736779 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB669_RS03655 (NB669_03655) | 731694..732296 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
NB669_RS03660 (NB669_03660) | 732394..733305 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NB669_RS03665 (NB669_03665) | 733306..734454 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
NB669_RS03670 (NB669_03670) | 734465..735841 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
NB669_RS03675 (NB669_03675) | 736486..736779 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NB669_RS03680 (NB669_03680) | 736776..737261 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
NB669_RS03685 (NB669_03685) | 737965..738558 | + | 594 | WP_004188553.1 | hypothetical protein | - |
NB669_RS03690 (NB669_03690) | 738655..738871 | + | 217 | Protein_725 | transposase | - |
NB669_RS03700 (NB669_03700) | 739548..740261 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 738655..738807 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T247499 WP_004150910.1 NZ_CP098347:736776-737261 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |