Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 326849..327435 | Replicon | chromosome |
| Accession | NZ_CP098343 | ||
| Organism | Klebsiella pneumoniae strain 53009_G1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | NB668_RS01515 | Protein ID | WP_002920800.1 |
| Coordinates | 327067..327435 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A0H3GZM4 |
| Locus tag | NB668_RS01510 | Protein ID | WP_002920802.1 |
| Coordinates | 326849..327070 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB668_RS01490 (NB668_01490) | 323006..323932 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NB668_RS01495 (NB668_01495) | 323929..325206 | + | 1278 | WP_002920806.1 | branched chain amino acid ABC transporter permease LivM | - |
| NB668_RS01500 (NB668_01500) | 325203..325970 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NB668_RS01505 (NB668_01505) | 325972..326685 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NB668_RS01510 (NB668_01510) | 326849..327070 | + | 222 | WP_002920802.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NB668_RS01515 (NB668_01515) | 327067..327435 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NB668_RS01520 (NB668_01520) | 327708..329024 | + | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NB668_RS01525 (NB668_01525) | 329131..330018 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NB668_RS01530 (NB668_01530) | 330015..330860 | + | 846 | WP_002920789.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NB668_RS01535 (NB668_01535) | 330862..331932 | + | 1071 | WP_002920787.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 323929..332669 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T247481 WP_002920800.1 NZ_CP098343:327067-327435 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZM4 |