247433

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13609..14266 Replicon plasmid p59174-171.4
Accession NZ_CP098334
Organism Citrobacter freundii strain 59174

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag NB664_RS26620 Protein ID WP_000270043.1
Coordinates 13916..14266 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NB664_RS26615 Protein ID WP_000124640.1
Coordinates 13609..13911 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB664_RS26565 (NB664_26565) 9234..9662 + 429 WP_000591074.1 hypothetical protein -
NB664_RS26570 (NB664_26570) 9719..10078 + 360 WP_000422768.1 hypothetical protein -
NB664_RS26575 (NB664_26575) 10078..10524 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
NB664_RS26580 (NB664_26580) 10521..11039 + 519 WP_000210756.1 nitrite reductase -
NB664_RS26585 (NB664_26585) 11039..11269 + 231 WP_000972663.1 hypothetical protein -
NB664_RS26590 (NB664_26590) 11256..12113 + 858 WP_001167032.1 hypothetical protein -
NB664_RS26595 (NB664_26595) 12139..12327 + 189 WP_001270411.1 hypothetical protein -
NB664_RS26600 (NB664_26600) 12344..12871 + 528 WP_001236377.1 thermonuclease family protein -
NB664_RS26605 (NB664_26605) 12929..13201 + 273 WP_001043047.1 HU family DNA-binding protein -
NB664_RS26610 (NB664_26610) 13289..13582 + 294 WP_001239997.1 chromosome segregation protein ParM -
NB664_RS26615 (NB664_26615) 13609..13911 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
NB664_RS26620 (NB664_26620) 13916..14266 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NB664_RS26625 (NB664_26625) 14429..14977 + 549 WP_001061574.1 transcriptional regulator -
NB664_RS26630 (NB664_26630) 15318..15512 + 195 WP_000343597.1 hypothetical protein -
NB664_RS26635 (NB664_26635) 15523..15894 + 372 WP_000516916.1 hypothetical protein -
NB664_RS26640 (NB664_26640) 15887..16357 + 471 WP_001281821.1 hypothetical protein -
NB664_RS26645 (NB664_26645) 16372..16707 - 336 WP_000683476.1 hypothetical protein -
NB664_RS26650 (NB664_26650) 16804..17292 + 489 WP_001273096.1 DUF1643 domain-containing protein -
NB664_RS26655 (NB664_26655) 17295..17792 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaFOX-5 / ant(2'')-Ia / catB3 / qacE / sul1 - 1..171445 171445


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T247433 WP_000270043.1 NZ_CP098334:c14266-13916 [Citrobacter freundii]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT247433 WP_000124640.1 NZ_CP098334:c13911-13609 [Citrobacter freundii]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References