Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 367119..367785 | Replicon | chromosome |
Accession | NZ_CP098330 | ||
Organism | Citrobacter freundii strain 59174 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8B5Q945 |
Locus tag | NB664_RS01710 | Protein ID | WP_003847996.1 |
Coordinates | 367468..367785 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | NB664_RS01705 | Protein ID | WP_003837894.1 |
Coordinates | 367119..367415 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB664_RS01685 (363095) | 363095..363568 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
NB664_RS01690 (363811) | 363811..364791 | + | 981 | WP_000019450.1 | IS5-like element ISKpn26 family transposase | - |
NB664_RS01695 (364994) | 364994..365713 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
NB664_RS01700 (365710) | 365710..367062 | + | 1353 | WP_250791508.1 | two-component system sensor histidine kinase EnvZ | - |
NB664_RS01705 (367119) | 367119..367415 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
NB664_RS01710 (367468) | 367468..367785 | - | 318 | WP_003847996.1 | hypothetical protein | Toxin |
NB664_RS01715 (367908) | 367908..369530 | - | 1623 | WP_044701411.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
NB664_RS01720 (369909) | 369909..371627 | + | 1719 | WP_047715944.1 | DUF4153 domain-containing protein | - |
NB664_RS01725 (371737) | 371737..372615 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 363811..364791 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T247421 WP_003847996.1 NZ_CP098330:c367785-367468 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B5Q945 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U6IRD5 |