Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1110132..1110781 | Replicon | chromosome |
Accession | NZ_CP098325 | ||
Organism | Leclercia adecarboxylata strain kcgeb_e1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NB069_RS05180 | Protein ID | WP_250588171.1 |
Coordinates | 1110419..1110781 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NB069_RS05175 | Protein ID | WP_250588170.1 |
Coordinates | 1110132..1110431 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB069_RS05165 (NB069_05165) | 1106572..1108533 | + | 1962 | WP_250588166.1 | PhoX family phosphatase | - |
NB069_RS05170 (NB069_05170) | 1108637..1110025 | + | 1389 | WP_250588168.1 | phenylalanine transporter | - |
NB069_RS05175 (NB069_05175) | 1110132..1110431 | - | 300 | WP_250588170.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NB069_RS05180 (NB069_05180) | 1110419..1110781 | - | 363 | WP_250588171.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NB069_RS05185 (NB069_05185) | 1111054..1112292 | + | 1239 | WP_250588179.1 | MFS transporter | - |
NB069_RS05190 (NB069_05190) | 1112307..1113332 | + | 1026 | WP_250588181.1 | sugar phosphate isomerase/epimerase | - |
NB069_RS05195 (NB069_05195) | 1113325..1114467 | + | 1143 | WP_250588183.1 | Gfo/Idh/MocA family oxidoreductase | - |
NB069_RS05200 (NB069_05200) | 1114543..1115523 | + | 981 | WP_250588184.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13853.82 Da Isoelectric Point: 8.0460
>T247409 WP_250588171.1 NZ_CP098325:c1110781-1110419 [Leclercia adecarboxylata]
MWEVETTDKFDEWFHNQKQALKEDILAALHILSEYGPQLGRPFVDTLKGSQFTNMKELRIQHAGDPVRAFFAFDPGRKAI
ILCAGNKTGTAEKRFYKQMIAIADAEFSKYLANQEAKWQR
MWEVETTDKFDEWFHNQKQALKEDILAALHILSEYGPQLGRPFVDTLKGSQFTNMKELRIQHAGDPVRAFFAFDPGRKAI
ILCAGNKTGTAEKRFYKQMIAIADAEFSKYLANQEAKWQR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|