Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3189085..3189705 | Replicon | chromosome |
Accession | NZ_CP098322 | ||
Organism | Burkholderia gladioli strain BK04 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NAL90_RS31915 | Protein ID | WP_105827411.1 |
Coordinates | 3189427..3189705 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A560VTG3 |
Locus tag | NAL90_RS31910 | Protein ID | WP_029951048.1 |
Coordinates | 3189085..3189408 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL90_RS31890 (NAL90_31880) | 3184798..3185211 | - | 414 | WP_013690200.1 | MarR family transcriptional regulator | - |
NAL90_RS31895 (NAL90_31885) | 3185319..3186497 | - | 1179 | WP_250805058.1 | HPP family protein | - |
NAL90_RS31900 (NAL90_31890) | 3186892..3187848 | + | 957 | WP_025100402.1 | LysR family transcriptional regulator | - |
NAL90_RS31905 (NAL90_31895) | 3187892..3188977 | - | 1086 | WP_105858126.1 | ionic transporter y4hA | - |
NAL90_RS31910 (NAL90_31900) | 3189085..3189408 | - | 324 | WP_029951048.1 | HigA family addiction module antitoxin | Antitoxin |
NAL90_RS31915 (NAL90_31905) | 3189427..3189705 | - | 279 | WP_105827411.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NAL90_RS31920 (NAL90_31910) | 3189948..3190616 | + | 669 | WP_025100406.1 | MarC family protein | - |
NAL90_RS31925 (NAL90_31915) | 3190734..3191603 | - | 870 | WP_105852705.1 | CPBP family intramembrane metalloprotease | - |
NAL90_RS31930 (NAL90_31920) | 3191877..3192599 | - | 723 | WP_250805059.1 | fumarylacetoacetate hydrolase family protein | - |
NAL90_RS31935 (NAL90_31925) | 3192748..3193848 | - | 1101 | WP_186036216.1 | helix-turn-helix transcriptional regulator | - |
NAL90_RS31940 (NAL90_31930) | 3194041..3194643 | - | 603 | WP_013690210.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10429.06 Da Isoelectric Point: 9.9309
>T247403 WP_105827411.1 NZ_CP098322:c3189705-3189427 [Burkholderia gladioli]
MIQSFRCKRTAALFAGESPPAWRAVVQVARRKLAMLDAAQALRDLAVPPGNQLEGLFGDRAGQYSIRINERWRLCFVWSS
RGPELVEIVDYH
MIQSFRCKRTAALFAGESPPAWRAVVQVARRKLAMLDAAQALRDLAVPPGNQLEGLFGDRAGQYSIRINERWRLCFVWSS
RGPELVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|