Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2137789..2138051 | Replicon | chromosome |
Accession | NZ_CP098257 | ||
Organism | Staphylococcus aureus strain M4 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | NB631_RS10220 | Protein ID | WP_073392962.1 |
Coordinates | 2137789..2137893 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2137888..2138051 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NB631_RS10205 (NB631_10210) | 2134585..2135367 | + | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
NB631_RS10210 (NB631_10215) | 2135435..2136292 | + | 858 | WP_000370937.1 | HAD family hydrolase | - |
NB631_RS10215 (NB631_10220) | 2136951..2137109 | - | 159 | WP_001792784.1 | hypothetical protein | - |
NB631_RS10220 (NB631_10225) | 2137789..2137893 | + | 105 | WP_073392962.1 | hypothetical protein | Toxin |
- | 2137888..2138051 | - | 164 | - | - | Antitoxin |
NB631_RS10230 (NB631_10235) | 2138335..2139426 | - | 1092 | WP_000495684.1 | hypothetical protein | - |
NB631_RS10235 (NB631_10240) | 2139692..2140672 | - | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
NB631_RS10240 (NB631_10245) | 2140674..2140994 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NB631_RS10245 (NB631_10250) | 2141146..2141811 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T247391 WP_073392962.1 NZ_CP098257:2137789-2137893 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 164 bp
>AT247391 NZ_CP098257:c2138051-2137888 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|