Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 1852707..1852891 | Replicon | chromosome |
| Accession | NZ_CP098257 | ||
| Organism | Staphylococcus aureus strain M4 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | NB631_RS08725 | Protein ID | WP_000482647.1 |
| Coordinates | 1852707..1852814 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1852831..1852891 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB631_RS08700 (NB631_08705) | 1848069..1848542 | + | 474 | WP_000456499.1 | GyrI-like domain-containing protein | - |
| NB631_RS08705 (NB631_08710) | 1848665..1849876 | - | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
| NB631_RS08710 (NB631_08715) | 1850058..1850717 | - | 660 | WP_000831298.1 | membrane protein | - |
| NB631_RS08715 (NB631_08720) | 1850777..1851919 | - | 1143 | WP_001176855.1 | glycerate kinase | - |
| NB631_RS08720 (NB631_08725) | 1852187..1852573 | + | 387 | WP_000779351.1 | flippase GtxA | - |
| NB631_RS08725 (NB631_08730) | 1852707..1852814 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 1852831..1852891 | - | 61 | - | - | Antitoxin |
| NB631_RS08730 (NB631_08735) | 1853462..1855225 | + | 1764 | WP_001064828.1 | ATP-binding cassette domain-containing protein | - |
| NB631_RS08735 (NB631_08740) | 1855250..1856983 | + | 1734 | WP_000486507.1 | ABC transporter ATP-binding protein | - |
| NB631_RS08740 (NB631_08745) | 1857214..1857381 | + | 168 | Protein_1721 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T247389 WP_000482647.1 NZ_CP098257:1852707-1852814 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT247389 NZ_CP098257:c1852891-1852831 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|