Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 2438445..2438625 Replicon chromosome
Accession NZ_CP098255
Organism Staphylococcus aureus strain N4

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag NB630_RS11945 Protein ID WP_001801861.1
Coordinates 2438530..2438625 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 2438445..2438502 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NB630_RS11920 (NB630_11920) 2433869..2436278 - 2410 Protein_2305 polysaccharide lyase 8 family protein -
NB630_RS11925 (NB630_11925) 2436803..2437245 + 443 Protein_2306 DUF1433 domain-containing protein -
NB630_RS11930 (NB630_11930) 2437245..2437688 + 444 WP_000731421.1 DUF1433 domain-containing protein -
NB630_RS11935 (NB630_11935) 2437688..2438131 + 444 WP_001037039.1 DUF1433 domain-containing protein -
NB630_RS11940 (NB630_11940) 2438306..2438407 - 102 WP_001791232.1 hypothetical protein -
- 2438445..2438502 + 58 - - Antitoxin
NB630_RS11945 (NB630_11945) 2438530..2438625 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
NB630_RS11950 (NB630_11950) 2439076..2439522 + 447 WP_000747804.1 DUF1433 domain-containing protein -
NB630_RS11955 (NB630_11955) 2439715..2440284 + 570 WP_000125075.1 ImmA/IrrE family metallo-endopeptidase -
NB630_RS11960 (NB630_11960) 2440284..2441651 + 1368 WP_001093574.1 FRG domain-containing protein -
NB630_RS11965 (NB630_11965) 2441800..2442372 - 573 Protein_2314 hypothetical protein -
NB630_RS11970 (NB630_11970) 2442470..2442814 - 345 WP_000627550.1 DUF3969 family protein -
NB630_RS11975 (NB630_11975) 2442855..2443481 - 627 WP_000669038.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T247385 WP_001801861.1 NZ_CP098255:c2438625-2438530 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT247385 NZ_CP098255:2438445-2438502 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References