Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2438454..2438634 | Replicon | chromosome |
| Accession | NZ_CP098253 | ||
| Organism | Staphylococcus aureus strain M0 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NB629_RS11935 | Protein ID | WP_001801861.1 |
| Coordinates | 2438539..2438634 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2438454..2438511 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NB629_RS11910 (NB629_11910) | 2433878..2436287 | - | 2410 | Protein_2303 | polysaccharide lyase 8 family protein | - |
| NB629_RS11915 (NB629_11915) | 2436812..2437254 | + | 443 | Protein_2304 | DUF1433 domain-containing protein | - |
| NB629_RS11920 (NB629_11920) | 2437254..2437697 | + | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| NB629_RS11925 (NB629_11925) | 2437697..2438140 | + | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| NB629_RS11930 (NB629_11930) | 2438315..2438416 | - | 102 | WP_001791232.1 | hypothetical protein | - |
| - | 2438454..2438511 | + | 58 | - | - | Antitoxin |
| NB629_RS11935 (NB629_11935) | 2438539..2438634 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| NB629_RS11940 (NB629_11940) | 2439085..2439531 | + | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| NB629_RS11945 (NB629_11945) | 2439724..2440293 | + | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NB629_RS11950 (NB629_11950) | 2440293..2441660 | + | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| NB629_RS11955 (NB629_11955) | 2441809..2442381 | - | 573 | Protein_2312 | hypothetical protein | - |
| NB629_RS11960 (NB629_11960) | 2442479..2442823 | - | 345 | WP_000627550.1 | DUF3969 family protein | - |
| NB629_RS11965 (NB629_11965) | 2442864..2443490 | - | 627 | WP_000669038.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T247372 WP_001801861.1 NZ_CP098253:c2438634-2438539 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT247372 NZ_CP098253:2438454-2438511 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|